<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04176
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MQAEQKQPVDHSGVPVEALEALRLRLTQLTHSLNKLQAEFKNPQLTHYVSLQAQLSIILTQLGSLSSTLSSYSDVLERTVAYPLPTFPTTEQEGLLTTLLRKKATPEVVEWIEESKSKNTDFLLKDDEDITKWAARCTVDTKEKYNFVGFKTKQEEREANGDDEKDVDIADEPAASSKYSVDQILKFMYQGDITK |
| Length | 195 |
| Position | Head |
| Organism | Cyberlindnera jadinii (strain ATCC 18201 / CBS 1600 / CCRC 20928 / JCM 3617 / NBRC 0987 / NRRL Y-1542) (Torula yeast) (Candida utilis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Phaffomycetaceae> Cyberlindnera.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.572 |
| Instability index | 40.74 |
| Isoelectric point | 4.92 |
| Molecular weight | 22070.55 |
| Publications | PubMed=26150016
PubMed=27535936
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | protein-macromolecule adaptor activity GO:0030674 IEA:EnsemblFungi
RNA polymerase II cis-regulatory region sequence-specific DNA binding GO:0000978 IEA:EnsemblFungi
TBP-class protein binding GO:0017025 IEA:EnsemblFungi
transcription corepressor activity GO:0003714 IEA:EnsemblFungi
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP04176
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 81.03| 28| 32| 2| 33| 1
---------------------------------------------------------------------------
2- 33 (35.67/35.72) QAEQKQP.VDHSgVPVEAleALRLRLTQLThSL
37- 65 (45.36/27.23) QAEFKNPqLTHY.VSLQA..QLSIILTQLG.SL
---------------------------------------------------------------------------
|