<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04172
| Description |
Uncharacterized protein |
| Sequence | MADILTQLQTCLDQLATQFYATLCYLTTYHDHSAATPPSNIPTAIPQLKKIPKNPPPTTTVSATAKGTSGAAASPQPQQPTTPAAAEAQAQQQESSPAEPTPDTPEIFALRQRELARDLIVKEQQIEYLISVLPGVGSSEAEQEERIRRLAEELRVVEAERTEKRREMRRLGERVDELLGAVEGRG |
| Length | 186 |
| Position | Middle |
| Organism | Blastomyces silveriae |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Ajellomycetaceae> Blastomyces.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.583 |
| Instability index | 64.68 |
| Isoelectric point | 5.09 |
| Molecular weight | 20382.67 |
| Publications | PubMed=26439490
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP04172
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 95.26| 20| 20| 74| 93| 1
---------------------------------------------------------------------------
52- 70 (27.96/10.49) .PKNPPPTTTVSATAKGTSG
74- 93 (36.59/15.56) SPQPQQPTTPAAAEAQAQQQ
96- 112 (30.71/12.10) SPAEPTPDTP...EIFALRQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 72.27| 17| 18| 142| 158| 2
---------------------------------------------------------------------------
122- 137 (19.92/11.36) .KEQQIEYLISVLPGVG
142- 158 (27.48/18.06) EQEERIRRLAEELRVVE
163- 177 (24.87/15.75) EKRREMRRLGE..RVDE
---------------------------------------------------------------------------
|