Description | Str. FM013 |
Sequence | MDPDSDYPPSDSSSSSSEDNKKNAPTMDSRPTAKELLDRVDYDISQLLQRFENIVAIAANKFDGTSHVDAAVEAFQIDVESTALIRAAEDLLALHRLMKELWLFGKLDTLGEDERDVKRREKLEEDVEAIQKALDGGLLMPSSDEPGDSEKSEDTQKSKDTEQSVKPEQSEK |
Length | 172 |
Position | Head |
Organism | Penicillium camemberti FM 013 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.864 |
Instability index | 63.91 |
Isoelectric point | 4.40 |
Molecular weight | 19172.82 |
Publications | PubMed=24407037 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP04163 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) KPEQSEK 2) MDPDSDYPPSD | 166 1 | 172 11 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab