<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04161
| Description |
"Mediator complex, subunit Med21" |
| Sequence | MADILTQLQTCLDQLATQFYATLGYLITYHDNAPTTPPPNIPDAAPALAKITKNSSSPPVPAAIANKVGGAAAVAGNASPPHAPPQQPGAAPGTAVDGEDPNLPPAPDSPSTFASRQRELARDLIIKEQQIEYLISVLPGIGASEAEQETRIRELETELRGVEKERAAKVRELKKLRTRLEDVLGAVAVGIHGDGYPQK |
| Length | 199 |
| Position | Middle |
| Organism | Penicillium camemberti FM 013 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.353 |
| Instability index | 56.85 |
| Isoelectric point | 5.26 |
| Molecular weight | 21022.50 |
| Publications | PubMed=24407037
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP04161
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.13| 17| 17| 69| 85| 1
---------------------------------------------------------------------------
69- 85 (32.25/14.06) GGAAAVAGNASPPHAPP
89- 105 (28.88/11.92) GAAPGTAVDGEDPNLPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 60.60| 16| 16| 145| 160| 2
---------------------------------------------------------------------------
127- 139 (12.92/ 6.56) ...KEQQIEYLISVLP
145- 160 (25.69/19.28) EAEQETRIRELETELR
163- 177 (21.98/15.58) EKERAAKVRELK.KLR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.41| 16| 21| 27| 43| 3
---------------------------------------------------------------------------
27- 43 (26.93/16.40) ITYHDNAPTTpPPNIPD
51- 66 (27.48/12.10) ITKNSSSPPV.PAAIAN
---------------------------------------------------------------------------
|