Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSDRTHPASFQARPPSPSSPAGSLKENHRLPISSEHIPQTPTSPPLMSVNEQSHAANFTSSHTSPNQATVQPPNISSPPSSAPMSTQVSQQPTMSATNSFPTPASSVSGHPANATSEDVDQGRKSFNMGIQDSAENSGAAPAQQPTQQPTQHRPTDHDRQSSQTESTNDFATGQGQHSTDPDAMDVDTEPTRRADTLSLDLDSLQKELTSAFHLCKSSPIVTGPDPSVDLVSLYGLGSIAHSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPHKQEIGAPGSLRYMTLWPEEEWQNQKVHGKAIKVSDMDSALQNLQSRAMQMEPGPIPNNDWWEDILGHEKQAKNPAPGETGKKVAPALTAGRPSMQSYAASPRSQEAERPRPSRGRKRNYDDNSFAGYGEGFVDDDDDPGFYSNGEGTGKKKRKKDHVAKVSTPMSERSTSYGVGMFGIGAR |
Length | 458 |
Position | Head |
Organism | Penicillium camemberti FM 013 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.947 |
Instability index | 57.14 |
Isoelectric point | 6.44 |
Molecular weight | 49378.68 |
Publications | PubMed=24407037 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP04160 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 90.92| 21| 27| 14| 39| 1 --------------------------------------------------------------------------- 14- 39 (35.15/28.88) PP....SPSSPAGSLkenhrLPISSEHI.P.Q 44- 67 (19.89/ 6.50) PPlmsvNEQSHAANF........TSSHTsPnQ 72- 90 (35.88/18.14) PP....NISSPPSS......APMSTQ.V.S.Q --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 82.94| 25| 27| 198| 223| 2 --------------------------------------------------------------------------- 198- 223 (39.40/33.63) SLDLDSLQKELTSAFHLCKSSPiVTG 227- 251 (43.54/31.93) SVDLVSLYGLGSIAHSVARMDP.VTG --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 134.06| 26| 27| 133| 158| 3 --------------------------------------------------------------------------- 95- 120 (43.81/22.04) SATNSFPTPASSVSGHPANATSEDVD 133- 158 (46.35/23.77) SAENSGAAPAQQPTQQPTQHRPTDHD 162- 187 (43.90/22.10) SQTESTNDFATGQGQHSTDPDAMDVD --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DWWEDILGHE 2) KKKRKKDHVAKVST | 336 426 | 345 439 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab