<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04154

Description "Mediator complex, subunit Med12"
SequenceMIPHSSAGGQSWGHPLRTFNGGPGRVDNAQMLGQYDQPDRSASLPQPPIRQPVVVDLTAGGPESQDREPPPKRPRLDVPSASHTSDTGPAAGETRSTPGSAISRPAVSWRGRPAWSFQAVVSEIPSNENRGDGAAGSKPPSPPPLPAQPWMNNFVAEPEGSGVVKSRESSPVGAVQTTPYRIEIPSVAPVYKGQKPADFAPWTGNHPEDVLSEQTAKQGYYDRTQVSQNESNTARPALYAQLKNRTGLQMLSSVFAAALEKRQSHNTIHAPSTFKPPPRVTLTDNKREAWLRDLANQSVPLRRLSRTIPHGIRGKILLDQCLGKWIPIARAVWLAKCVGANEIRAFKRKGTSGALAVGLEAKWVRDWTTNVQQFVEGVFAAPKSSDWKAKMTYAVGLTARLFSENLLDHDHFLEWFLSSFEAASIGTISVWLLMLGIYWNSIMRYRRRGRRLAELLLQKVRQATEAKLTQLQPLIDRLSRFIKKLVLDHTSSMILPNSWETYQQQVSSSLDLGNQAEKALFQSLAERNARVQRPRHSKQTTQRSPHQRIVRLLDSIRSAQDLSSVFGYLDAFDDKAVLVFKLLEWLSTPFRHGLCRVYIGVRLLRKWKLAGVDIDSHILAFLSRGQNNQKLNMDQIYHVVSELVRSQTFSVGRYLQWLMARGVANGSSSGEERKVKDLPIDIGLIAQLPVARLPEHVGNLRSTLLTRTGLSTSEENAAIDSVKEIISQRLPGIFGVHESASMALDSFPPNLPWAVKAEVGQWLRRAIAEHNRSAESTNKGAFPVDIASVVSALTPTEFYTVRDALESFGDISMLADVLKFASSCGDSTVLASVADTTNCHFDSLCVIGATTDLFRRLIDAYAGIKRFGMPSLDLIFSLIELGLRIPSDLNTVSILRQDLSRMENKAIMAASSPVSDHIPDGFGGVDPFFREKLDQLLQSGNVMDEPTLDAIFNTLIKHLESDDGHANLSANDTCRYLAQLRSFHPKHFDGILARWVCGHLRSPERTILLRILPPLIGVGCVTIRAFLALAKKLTLSKPATVPNAAQLPADLVQLLVSGDEDSKSFDLVSYRFQLAQQEFLNKNSEEALKIVCDAASSNAGSPSTGHTEMERSIIMLLRDLLVRHPECAAQNGMQKLMDQYPAALSIVQKALDLLLGIESQSDSSSVLSKVEKLACMTDDFSLPFCQLKLQVLFHADSGSEDRTNIVDAMFKTAVSDCRAHRLHWVDLVALMSPDAVRQIRERAEKEFFSIPLLEEPIGDIPDSPDKLGSLETAKMYLTIIEELASSIPDSGAPSVAPVLVEKMDSLLHKIITIHNSTLAKGVANTDRSKCERALAFWFSALLRIIVLHRSAFSQPPPALKINPLHEQLRLLTSIFCIALSRLPGDVLRLFPAADYFPHPTPTEGFRPCPGILLQTHALDVAASLIDIFPDEVRHQCARFLKEKCPSFVPFQNDSRFLYLLGPISDQYPANAPQASAPSPAASGSTPTPTPALFSIVGSSTAQQSATAASGPSTAPPDSNSMAKRLRLQHRGRVVGPYPVRPWELLEDAAPFLGVNDTAVSLGFFDARRVRA
Length1571
PositionKinase
OrganismPenicillium camemberti FM 013
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
Aromaticity0.07
Grand average of hydropathy-0.187
Instability index49.93
Isoelectric point8.67
Molecular weight172861.53
Publications
PubMed=24407037

Function

Annotated function Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. 
ECO:0000256	ARBA:ARBA00002895
ECO:0000256	ARBA:ARBA00003744
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP04154
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     180.17|      45|      71|    1365|    1409|       1
---------------------------------------------------------------------------
 1332- 1368 (55.02/23.45)	RALAFWFSALLR.....IIVLH...RSA..FSQPPPALKINP.........................lHEQL
 1369- 1437 (70.10/31.72)	RLLTSIFCIALSRLPGDVLRLF...PAADYFPHPTPTEGFRPCPgillqthaldvaaslidifpdevrHQCA
 1438- 1479 (55.04/23.46)	RFLKEK.CPSFVPFQNDSRFLYllgPISDQYPANAP.QASAPSP............................
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     141.30|      45|      71|     662|     709|       2
---------------------------------------------------------------------------
  662-  709 (65.96/49.31)	GVANGSSSGEERKVKDLPIDI.GLIAQLPVARLPEHvgNlRSTLLTRTG
  735-  780 (75.35/45.70)	GVHESASMALDSFPPNLPWAVkAEVGQWLRRAIAEH..N.RSAESTNKG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      26.31|      10|      18|     857|     871|       3
---------------------------------------------------------------------------
  857-  871 ( 8.59/18.00)	LIDayAGIKrfgMPS
  878-  887 (17.72/ 8.00)	LIE..LGLR...IPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     118.43|      22|      74|      56|      77|       4
---------------------------------------------------------------------------
   33-   50 (23.06/ 6.55)	....GQ.YDQPDRSAS.L....PQPPIR
   56-   77 (39.58/16.60)	DLTAGG.PESQDREPP.P....KRPRLD
   83-  108 (26.75/ 8.79)	HTSDTG.PAAGETRST.PgsaiSRPAVS
  132-  152 (29.03/10.18)	DGAAGSkPPS...PPPlP....AQPWMN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.06|      20|      35|    1249|    1270|      13
---------------------------------------------------------------------------
 1249- 1270 (32.04/26.07)	SIplLEEPIGDIPDS.........PDKLGSL
 1278- 1306 (27.02/14.40)	TI..IEELASSIPDSgapsvapvlVEKMDSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.43|      13|      15|     309|     323|      14
---------------------------------------------------------------------------
  309-  323 (19.53/18.65)	PhgIRGKILLDQCLG
  327-  339 (24.90/14.91)	P..IARAVWLAKCVG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      83.30|      28|     279|     218|     245|      15
---------------------------------------------------------------------------
  195-  234 (39.51/23.05)	KPADFAPWTGNhpedvlseqtakQGYYDRTQVSQNESNTA
  500-  516 (18.03/ 6.52)	.......................ETYQQQVSSSLDLGNQA
  517-  537 (25.76/12.46)	EKALFQSLAER............NARVQRPRHS.......
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.53|      20|      37|    1134|    1155|      20
---------------------------------------------------------------------------
 1134- 1155 (27.51/19.47)	QKL...MDQYpaALSIVQKALDLLL
 1171- 1193 (30.02/14.85)	EKLacmTDDF..SLPFCQLKLQVLF
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP04154 with Med12 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) FQAVVSEIPSNENRGDGAAGSKPPSPPPLPAQPWMNNFVAEPEGSGVVKSRESSPVGAVQTTP
2) GQKPADFAPWTGNHPEDVLSEQTAKQGYYDRTQVSQNESNTARPALY
3) MIPHSSAGGQSWGHPLRTFNGGPGRVDNAQMLGQYDQPDRSASLPQPPIRQPVVVDLTAGGPESQDREPPPKRPRLDVPSASHTSDTGPAAGETRSTPGSAISRPAVSW
117
193
1
179
239
109










Molecular Recognition Features






MoRF SequenceStartStop




NANANA