<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04151
| Description |
Mediator of RNA polymerase II transcription subunit 17 |
| Sequence | MADSLTLPLRPIPEKRDRPDTLPVEIAQINNQWGSFREVNEEVLRNKIAEEEEKDGLDEVDESDQDASDLDSTERLEQLYKRRAEITQFAMQAHMETMFALDFVSLLLSKQAPRQAETSMSAFLKQVAPLGSLNAEVVNPPPKPESKTKDISAVSRGWRIQNFNAAANKLLQAASRLETEVASETRYWNEVLAVKDKGWKVSRLPSEKQSLGVQYGFLEATPVFRDRGLASLRRAEDGALLLDEGLIPSKARFVRVRVIQNGRLSGSSKPTRSTFNGNETIEDRILQARDTVYEEELFHELVREARAIASFGVTTRQNLIQIPASDDLEILLDLVDTDEDTPEPEHDVSQKRTSLAEGLAHTIRILLAYAHRQNLRRRTLLPLPLTPKTRSVPEHQLIRPALAYIKHMSHVRWLQSLLKDLFGVLQSAGVKPPAYTSRVFSTARSQTSPDPAVETLVGQFLTPLLSTFNGKILTPRGSFSIAIHTNLSSPPFGTVFDVSFNMPKYPDLESPGKLSHREEVEAAITHLLLLDVVFTVSSNSGLPQPESDKDQAKRTWEAIYPQHGELLIPSKSEKRTKMKIALDRHKLSLEIYAVGCIDGTGRGHWELPASHSMPHTWKPSPIAGLPKQSSLMDYVSTNVLLS |
| Length | 642 |
| Position | Head |
| Organism | Penicillium camemberti FM 013 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.415 |
| Instability index | 52.07 |
| Isoelectric point | 6.20 |
| Molecular weight | 71852.74 |
| Publications | PubMed=24407037
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364140
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04151
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 116.36| 35| 46| 331| 366| 1
---------------------------------------------------------------------------
331- 366 (53.62/37.53) LLDLVDTDEDTPEPEHDVSQKRTSLAEGLAHtIRIL
380- 414 (62.74/39.81) LLPLPLTPKTRSVPEHQLIRPALAYIKHMSH.VRWL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.57| 14| 192| 270| 289| 2
---------------------------------------------------------------------------
270- 289 (21.10/29.73) PTRSTFNGnetiedRILQAR
463- 476 (27.47/19.38) PLLSTFNG......KILTPR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.72| 21| 38| 150| 170| 4
---------------------------------------------------------------------------
150- 170 (35.48/23.42) DISAV.SRGWRIQNFNAAANKL
190- 211 (30.24/18.98) EVLAVkDKGWKVSRLPSEKQSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 72.46| 16| 33| 496| 511| 6
---------------------------------------------------------------------------
478- 490 (16.17/ 6.25) ...SFSIAIHTNLSSP
496- 511 (30.18/17.42) FDVSFNMPKYPDLESP
530- 545 (26.10/14.16) LDVVFTVSSNSGLPQP
---------------------------------------------------------------------------
|