<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04151

Description Mediator of RNA polymerase II transcription subunit 17
SequenceMADSLTLPLRPIPEKRDRPDTLPVEIAQINNQWGSFREVNEEVLRNKIAEEEEKDGLDEVDESDQDASDLDSTERLEQLYKRRAEITQFAMQAHMETMFALDFVSLLLSKQAPRQAETSMSAFLKQVAPLGSLNAEVVNPPPKPESKTKDISAVSRGWRIQNFNAAANKLLQAASRLETEVASETRYWNEVLAVKDKGWKVSRLPSEKQSLGVQYGFLEATPVFRDRGLASLRRAEDGALLLDEGLIPSKARFVRVRVIQNGRLSGSSKPTRSTFNGNETIEDRILQARDTVYEEELFHELVREARAIASFGVTTRQNLIQIPASDDLEILLDLVDTDEDTPEPEHDVSQKRTSLAEGLAHTIRILLAYAHRQNLRRRTLLPLPLTPKTRSVPEHQLIRPALAYIKHMSHVRWLQSLLKDLFGVLQSAGVKPPAYTSRVFSTARSQTSPDPAVETLVGQFLTPLLSTFNGKILTPRGSFSIAIHTNLSSPPFGTVFDVSFNMPKYPDLESPGKLSHREEVEAAITHLLLLDVVFTVSSNSGLPQPESDKDQAKRTWEAIYPQHGELLIPSKSEKRTKMKIALDRHKLSLEIYAVGCIDGTGRGHWELPASHSMPHTWKPSPIAGLPKQSSLMDYVSTNVLLS
Length642
PositionHead
OrganismPenicillium camemberti FM 013
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
Aromaticity0.06
Grand average of hydropathy-0.415
Instability index52.07
Isoelectric point6.20
Molecular weight71852.74
Publications
PubMed=24407037

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP04151
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     116.36|      35|      46|     331|     366|       1
---------------------------------------------------------------------------
  331-  366 (53.62/37.53)	LLDLVDTDEDTPEPEHDVSQKRTSLAEGLAHtIRIL
  380-  414 (62.74/39.81)	LLPLPLTPKTRSVPEHQLIRPALAYIKHMSH.VRWL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.57|      14|     192|     270|     289|       2
---------------------------------------------------------------------------
  270-  289 (21.10/29.73)	PTRSTFNGnetiedRILQAR
  463-  476 (27.47/19.38)	PLLSTFNG......KILTPR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.72|      21|      38|     150|     170|       4
---------------------------------------------------------------------------
  150-  170 (35.48/23.42)	DISAV.SRGWRIQNFNAAANKL
  190-  211 (30.24/18.98)	EVLAVkDKGWKVSRLPSEKQSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      72.46|      16|      33|     496|     511|       6
---------------------------------------------------------------------------
  478-  490 (16.17/ 6.25)	...SFSIAIHTNLSSP
  496-  511 (30.18/17.42)	FDVSFNMPKYPDLESP
  530-  545 (26.10/14.16)	LDVVFTVSSNSGLPQP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP04151 with Med17 domain of Kingdom Fungi
Unable to open file!