<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04148
| Description |
Mediator of RNA polymerase II transcription subunit 4 (Fragment) |
| Sequence | MDEFIDARFERVEKALASLVESVSKYHPYAKQALDLQEADKELSQGLELVQQHQNNHLRLQELRTTSSALDAQIRETLSTLASTRRDITTTHITVHGDEDHYPIKYEELLNYARRISKTTLPPAGVTNGVTFEPAASEDPPAGAVTNGVQSAVTSAAPTPSGAPTPGAPTPGAQTPAAPTPTAQQLPDPSSGPNGATSQPPEQPGAAPGDNPSGAPLGITTALPSGLRDHLDANHGTIFLPWPNEYQIGGGALAACQDLSERGIDPRGYDPVANM |
| Length | 275 |
| Position | Middle |
| Organism | Verticillium longisporum |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Glomerellales> Plectosphaerellaceae> Verticillium.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.538 |
| Instability index | 49.13 |
| Isoelectric point | 4.82 |
| Molecular weight | 28973.57 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04148
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
5| 140.51| 18| 18| 141| 158| 1
---------------------------------------------------------------------------
123- 134 (22.97/ 8.80) PAG.VTNG..VTFE.....P
141- 158 (33.03/16.05) PAGAVTNG..VQSAVTSAAP
160- 179 (31.54/14.98) PSGAPTPGapTPGAQTPAAP
193- 208 (28.77/12.98) PNGATSQP..PEQP..GAAP
212- 224 (24.20/ 9.68) PSGA.......PLGITTALP
---------------------------------------------------------------------------
|