<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04143

Description Mediator of RNA polymerase II transcription subunit 5
SequenceMEGRASRSAQQIALSRWQKFIANSLAKRLDPERFESYAPILYSKHPLPXPICLVSPLNEDLPQMVEGVFSEQIDLQIQATTKFRKLLSKERNXDPRIPQYLQSLSKLRYIDIPSVLKGLYRYSTSHTQAHPADGQAPEGDGEATRLIRWGSSYGSEEVMFYRLTKAVAQGAAIQNAAVALEIAKIMSKWMTLFTDASTAFAVDPMGQMQANQARDEMDCARAAFVALLLGVCENQVVLKALSRPQAAAARKAMSEGLATFVPTIMHNAGPVTTRLDHFRTRILASFEPAEAGKPLAAPELDQLFDSGVELNNFVIPELPVANSRAGLYIYLNAALVGRPLIDDTAIFNYLNNRYQGDVQSTTIDLILASFDVLANAVFRNEGNKAAHMLRSYLMNKLPILISNLSKHMYPPLTAEYCITEALSHVDTNAFPTLSSMFDESRNNNPYTDSVREEFCWACCLHGLLRESSIETILGETPYQSLPSRGRYVKDTLVAECLDDPERMQALVKELDNMDGNVGAVCHALTEVLAQLCRNKETMSLKNLCSQLSRRPLSLDVILLFEKPTAILQPLCDLLDDWKYDEDQGEYQPVYEEFGSVLLLLLAFTYRYNLTASDIGARSPDSFVAKFLSQGHLSRSSEELSDLEKSHLGGWIHGLFDQEAGGLTDDLISSCPPQEFYLLIPTLFQNVMTAFATGHLSEESLKGGVEYLVDTFLLPSLVTAITYLANSLWVERHNQNTIIRVLHLVLQPSAISEEAKTMLSSVLNIVAKPLEHSLRASQRQDPKDQKIDLLLSVLKDNIPLSRRTGGADHNELETWTSTQGEGLATALRHTMQGFVQWSXXXELSDLEKSHLGGWIHGLFDQEAGGLTDDLISSCPPQEFYLLIPTLFQNVVTAFATGHLSEESLKGGVEYLVDTFLLPSLVTAITYLANSLWVERHNQNTIIRVLHLVLQPSAISEEAKTMLSSVLNIVAKPLEHSLRASQRQDPKNQKIDPLLGVLKDNIPLSRRTGGADHNELETWTSTQGEGLATALRHTMQGFVQWSLHPGINITPTSYSHRQVLAALRLLGAKRVFRLICEEVKQQTEAGGGSVVYDVATALVCAPEVTNNPQTPGLTFFEDSGNMPTPVQRRLTLRDVLKAEAEDCRRLQRTDMSQAELVVRLHRRVEAQMAVSEAEAIHAEAILQGDLGLGLDDAAGSLSEAMAAAAANAGPTGGAMTVDSVGLDLGMGGVGGDLDLGDATGNGGSLDLGADDIFSGLSAGGDFEWDTMDLG
Length1268
PositionTail
OrganismVerticillium longisporum
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Glomerellales> Plectosphaerellaceae> Verticillium.
Aromaticity0.07
Grand average of hydropathy-0.125
Instability index45.62
Isoelectric point5.07
Molecular weight138676.96
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP04143
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     889.30|     183|     200|     638|     837|       1
---------------------------------------------------------------------------
  191-  259 (61.47/26.09)	............................TLFTDASTAFA......................................................................................vdPM.GQMQANQARDEMDcaraAFVALLLGVCENQVvlkALSRPQAAAARKAM.......SEGLAT.............
  378-  469 (77.67/36.11)	FRNE.GNKAAHMLRS......YLMnkLPILISNLSKHMYPPLTAEYCITEALSH.VDTNAFPTL........SSMFDESRNNNPYtdsVReefcwacCLHGLLRESSI................................................................................................
  655-  837 (375.00/244.43)	FDQEAGGLTDDLISSCPPQEFYLL..IPTLFQNVMTAFATGHLSEESLKGGVEYLVDTFLLPSLVTAITYLANSLWVERHNQNTI...IR.......VLHLVLQPSAISEEAKTMLSSVLNIVAK..PLEHSLRASQRQDPKD....QKIDLLLSVLKDNI...PLSRRTGGADHNELETWTSTQGEGLATALRHTMQGFVQWS
  858- 1040 (375.17/217.54)	FDQEAGGLTDDLISSCPPQEFYLL..IPTLFQNVVTAFATGHLSEESLKGGVEYLVDTFLLPSLVTAITYLANSLWVERHNQNTI...IR.......VLHLVLQPSAISEEAKTMLSSVLNIVAK..PLEHSLRASQRQDPKN....QKIDPLLGVLKDNI...PLSRRTGGADHNELETWTSTQGEGLATALRHTMQGFVQWS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      76.15|      17|     201|     638|     654|       2
---------------------------------------------------------------------------
  638-  654 (38.07/25.18)	ELSDLEKSHLGGWIHGL
  841-  857 (38.07/25.18)	ELSDLEKSHLGGWIHGL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.08|      27|      33|    1202|    1234|       3
---------------------------------------------------------------------------
 1184- 1230 (30.65/31.48)	LGLGlddaagslseamaaAAANAGPTG.GAMTVDSvGLDLgmggvGGD
 1231- 1259 (42.43/23.64)	LDLG.............dATGNGGSLDlGADDIFS.GLSA.....GGD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.81|      17|      22|    1065|    1085|       4
---------------------------------------------------------------------------
 1069- 1085 (29.96/27.57)	VFR....LIC.EEVKQQTEAGG
 1089- 1110 (22.86/ 8.38)	VYDvataLVCaPEVTNNPQTPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      58.68|      14|      34|    1125|    1138|       5
---------------------------------------------------------------------------
 1125- 1138 (21.24/14.08)	QRRLTLRDVLKAEA
 1151- 1164 (18.98/11.73)	QAELVVRLHRRVEA
 1165- 1178 (18.47/11.19)	QMAVSEAEAIHAEA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.94|      14|      38|     296|     312|       7
---------------------------------------------------------------------------
  296-  312 (20.93/18.58)	AA....PELD..QLFDsgvELNN
  333-  352 (16.01/ 6.01)	AAlvgrPLIDdtAIFN...YLNN
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP04143 with Med5 domain of Kingdom Fungi
Unable to open file!