<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04137
| Description |
Uncharacterized protein (Fragment) |
| Sequence | MAANFWDSTQRRYWQFTKDGLATMRQKLEDENTELVQLFPLPQLLLTGEALDLLVSVLFLPEINRLGKRLGVRQQAMATAQVYIKRFYTKIEIRRTNVYLVIATAVYLSCKMEECPQHVRLIVSEARSLWPDFVSLDTSKLGECEFFLISEMSSQLIVHQPYRTLTAFQGDLALTQEDTALAWSIINDHYMTDLPLL |
| Length | 197 |
| Position | Kinase |
| Organism | Verticillium longisporum |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Glomerellales> Plectosphaerellaceae> Verticillium.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.007 |
| Instability index | 52.28 |
| Isoelectric point | 5.42 |
| Molecular weight | 22782.13 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04137
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.45| 17| 18| 35| 51| 1
---------------------------------------------------------------------------
35- 51 (28.46/18.29) LVQLFPLPQLLLTGEAL
54- 70 (27.98/17.88) LVSVLFLPEINRLGKRL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.76| 18| 22| 82| 102| 2
---------------------------------------------------------------------------
82- 102 (24.28/24.05) VYIKrfyTKIEIRRTNVYLVI
106- 123 (33.48/21.74) VYLS...CKMEECPQHVRLIV
---------------------------------------------------------------------------
|