Description | Uncharacterized protein |
Sequence | MTDRLTQLQDAVDQLAQQFVACFHYVNRHHDLEVLGPKDKVRDVTKGASQLEVEPADPEEFRAGLLELSRDLILKEQQIEVLISTLPGLDTSEADQEKNVRELEEELKIAEVQRQEAIKEKDQILVKLDEVIRNVRRP |
Length | 138 |
Position | Middle |
Organism | Verticillium longisporum |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Glomerellales> Plectosphaerellaceae> Verticillium. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.589 |
Instability index | 47.34 |
Isoelectric point | 4.74 |
Molecular weight | 15893.79 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669 ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP04135 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 55.37| 20| 22| 93| 114| 1 --------------------------------------------------------------------------- 93- 114 (27.86/20.60) EADQEKN..VRELEEelKIAEVQR 116- 137 (27.51/14.51) EAIKEKDqiLVKLDE..VIRNVRR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 38.99| 12| 26| 42| 53| 2 --------------------------------------------------------------------------- 42- 53 (19.51/12.42) RDVTKGASQLEV 70- 81 (19.48/12.39) RDLILKEQQIEV --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EFRAGLLELS 2) QEKNVREL | 60 96 | 69 103 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab