<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04133
Description |
Uncharacterized protein (Fragment) |
Sequence | MSFHPQTPQSPSQLSPGTSDLASSMNSSLTSLTTLPTPAHSVNGSTSHPPDTSHDYAMGDDTPQKRKRSIGDVGERDQKKPHVEDGKLDIDDLHQDVGEKYLLCQTTSPPKSHVRNPMVTRPSRTACARLTRATSSDWASW |
Length | 141 |
Position | Head |
Organism | Verticillium longisporum |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Glomerellales> Plectosphaerellaceae> Verticillium.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.946 |
Instability index | 49.84 |
Isoelectric point | 6.64 |
Molecular weight | 15378.76 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP04133
No repeats found
No repeats found
|