<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04124
| Description |
Uncharacterized protein (Fragment) |
| Sequence | MDLSERGIDPRGYDPVAVAAEAKRREEEDKAAKAELERRKAEETRRKREEWEANQRRRAAEAAQKPEPSATSPAPAAGKNAQFQFTSMDMDDDDDD |
| Length | 96 |
| Position | Middle |
| Organism | Verticillium longisporum |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Glomerellales> Plectosphaerellaceae> Verticillium.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.499 |
| Instability index | 74.21 |
| Isoelectric point | 4.83 |
| Molecular weight | 10863.65 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP04124
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.40| 15| 29| 21| 35| 1
---------------------------------------------------------------------------
21- 35 (24.31/ 8.97) EA.KRREEEDKAAKAE
52- 67 (21.09/ 7.03) EAnQRRRAAEAAQKPE
---------------------------------------------------------------------------
|