<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04120
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSFHPQTPQSPSQLSPGTSDLASSMNSSLTSLTTLPTPAHSVNGSTSHPPDTSHDYAMGDDTPQKRKRSIGDVGERDQKKPHVEDGKLDIDDLHQDVGEKYLLCQTPHRTQEFPCITEDLFEMFGLTDIAAEVAREKSNGDKTIKNGLRKTYKGHIKRLGIMGRFDSVAQEWEEPEEVDDDADQDEDDRPTQKKEKSNEPYFGFGKIMNLSDPEFWHGRSYLMHGLTPRARAELPKALAMAKGQIPEGFDASVLNDDGSRPAAAARSAAPGTPIGTPGSNMGQLKQAQGIPRPQRVNKKRGYGDXSFEGYEGYEDGYATGDGDDRGGQKRRKKAVGTPQFQNGTPRPSYGSGIGV |
| Length | 355 |
| Position | Head |
| Organism | Verticillium longisporum |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Glomerellales> Plectosphaerellaceae> Verticillium.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.995 |
| Instability index | 39.99 |
| Isoelectric point | 5.64 |
| Molecular weight | 38720.22 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04120
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 112.74| 26| 62| 247| 273| 1
---------------------------------------------------------------------------
176- 196 (28.54/10.96) EEVDDDADQDED.DRPTQKKEK.....
247- 272 (42.54/21.85) EGFDASVLNDDG.SRPAAAARSAAPGT
311- 337 (41.66/12.28) EGYEDGYATGDGdDRGGQKRRKKAVGT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.90| 11| 23| 72| 82| 4
---------------------------------------------------------------------------
72- 82 (21.80/11.10) DVGERDQ..KKPH
96- 108 (17.10/ 7.45) DVGEKYLlcQTPH
---------------------------------------------------------------------------
|