| Description | Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSFHPQTPQSPSQLSPGTSDLASSMNSSLTSLTTLPTPAHSVNGSTSHPPDTSHDYAMGDDTPQKRKRSIGDVGERDQKKPHVEDGKLDIDDLHQDVGEKYLLCQTPHRTQEFPCITEDLFEMFGLTDIAAEVAREKSNGDKTIKNGLRKTYKGHIKRLGIMGRFDSVAQEWEEPEEVDDDGDQDEDDRPTQKKEKSNEPYFGFGKMMNLSDPEFWHGRSYLMQGLTPRARAELPKALAMAKGQIPEGFDASVLNDDGSRPAAAARSAAPGTPIGTPGSNMGQLKQAQGIPRPQRVNKKRGYGDNSFEGYEGYEDGYATGDGDDRGGQKRRKKAVGTPQFQNGTPRPSYGSGIGV |
| Length | 355 |
| Position | Head |
| Organism | Verticillium longisporum |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Glomerellales> Plectosphaerellaceae> Verticillium. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -1.017 |
| Instability index | 39.15 |
| Isoelectric point | 5.56 |
| Molecular weight | 38829.32 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP04114
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 186.28| 49| 62| 224| 273| 1
---------------------------------------------------------------------------
175- 203 (30.78/10.77) .......................PEEVDDDGDQDED.DRPTqKKEKSNEPYFG
224- 273 (78.39/42.11) QGLtPR.ARAELPKALAMAKGQIPEGFDASVLNDDG.SRPA.AAARSAAPGTP
288- 338 (77.12/37.85) QGI.PRpQRVNKKRGYGDNSFEGYEGYEDGYATGDGdDRGG.QKRRKKAVGTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.90| 11| 23| 72| 82| 2
---------------------------------------------------------------------------
72- 82 (21.80/12.75) DVGERDQ..KKPH
96- 108 (17.10/ 8.58) DVGEKYLlcQTPH
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) EGYEGYEDGYATGD 2) GQKRRKKAVGTPQFQNGTP 3) PYFGFGK | 308 327 200 | 321 345 206 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab