<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04113
Description |
Uncharacterized protein (Fragment) |
Sequence | SLTVTTRLATTNATVCAANMTDRLTQLQDAVDQLAQQFVACFHYVNRHHDLEVLGPKDKVRDVTKGASQLEVEPADPEEFRAGLLELSRDLIVKEQQIEVLISTLPGLDTSEADQEKNVRELEEELKIAEVQRQEAIKEKDQILVKLDEVIRNVRRP |
Length | 157 |
Position | Middle |
Organism | Verticillium longisporum |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Glomerellales> Plectosphaerellaceae> Verticillium.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.457 |
Instability index | 39.91 |
Isoelectric point | 4.82 |
Molecular weight | 17769.88 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP04113
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.37| 20| 22| 112| 133| 1
---------------------------------------------------------------------------
112- 133 (27.86/21.76) EADQEKN..VRELEEelKIAEVQR
135- 156 (27.51/15.37) EAIKEKDqiLVKLDE..VIRNVRR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.99| 12| 26| 61| 72| 2
---------------------------------------------------------------------------
61- 72 (19.50/12.14) RDVTKGASQLEV
89- 100 (19.49/12.13) RDLIVKEQQIEV
---------------------------------------------------------------------------
|