<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04109
Description |
Uncharacterized protein |
Sequence | MDLISQIQSFVRTLASSLAHTVEYFQAQSPSVPADYREFDTDALRDRADNLFKLFADTDTLMASLPAEFPSEDEQIRLIAELSEENDKLGVELEQALASSETWRQRLSTVLEDVAEQQFKTYT |
Length | 123 |
Position | Middle |
Organism | Plasmodiophora brassicae (Clubroot disease) |
Kingdom | Rhizaria |
Lineage | Eukaryota> Sar> Rhizaria> Endomyxa> Phytomyxea> Plasmodiophorida>
Plasmodiophoridae> Plasmodiophora.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.402 |
Instability index | 42.11 |
Isoelectric point | 4.20 |
Molecular weight | 13996.29 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
mitochondrion GO:0005739 IEA:UniProtKB-KW
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP04109
No repeats found
No repeats found
|