<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04105

Description Mediator complex subunit 12-like (Fragment)
SequenceXFPIPLDESSSHECNQRTILLYGVGKERDEARHQLKKITKDILKILNKKSTTESGVGDEGQKARKNKQEVFPTPENVFTKLQLLSYFDQHQVTSQISNNVLEQITSFASGTSYHLPLAHHIQLIFDLMEPALNINGLIDFAIQLLNELSVVEAELLLKSSSLAGSYTTGLCVCIVAVLRRYHSCLILNPDQTAQVFEGLCGVVKHVVNPSECSSPERCILAYLYDLYVSCSHLRSKFGDLFSSACSKVKQTIYNNVMPANSNLRWDPDFMMDFIENPSARSINYSMLGKVLNDNAANRYSFVCNTLMNVCMGHQDAGRINDIANFSSELTACCTVLSSEWLGVLKALCCSSNHVWGFNDVLCTVDVSDLSFHDSLATFIAILIARQCFSLEDVVQHVALPSLLAAACGDADAEPGARMTCRLLLHLFRAPQACFFPQATGKPFPGIRSSCDRHLLAAAHNSIEVGAVFAVLKAIMMLGDAKIGSNNVNTLKNEDFSMRGLRRDGSAEDAWATSQNSKPYGKSISIETANLREYARYVLRTICQQEWVGEHCLKEPERLCTDKELILDPVLSNMQAQKLLQLICYPHGIKECTEGDNLQRQHIKRILQNLEQWTLRQSWLELQLMIKQCLKDPSSGSVAEMNNLLDNIAKATIEVFQQSADLNNNASSSGMSLFNPNTIGSVDPSSTRQNGIKTFLSSSERRGVWLVAPLIARLPTSVQGRVLKAAGEELEKGQHLGSSSKKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLLTSLQNQVNQILSNWREERYQDDTKARQMMHEALQLRLNLVGGMFDTVQRSTQGTTDWALLLLQIITSGTVDMHTNNELFTTVLDMLGVLINGTLASDLSTASPGGSEENKRAYMNLVKKLKKELGDKRSESIDKVRQLLPLPKQTCDVITCEPMGSLIDTKGNKIAGFDSIDKKQGLQVSTKQKVSPWDLFEGQKNPAPLSWAWFGTVRVDRRVIKYEEQHHFLLYHTHTMPKPRSYYLEPLPLPPEEEEEEPTSPVSQEPERKSAELSDHGKSAADEEKKTKGRKRKTKSSSRIDEYQQTNIYRLPPNYSPMSSQMMHHTQPALWGYNLVSQPQQPSFFLQNQSLNAGGSRLDPAGSFVPTNTKQALSNMLQRRSGAMLQPPSLHAVTSQQQLLQMKL
Length1177
PositionKinase
OrganismRattus norvegicus (Rat)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae> Murinae> Rattus.
Aromaticity0.06
Grand average of hydropathy-0.351
Instability index55.33
Isoelectric point7.19
Molecular weight131393.47
Publications
PubMed=15057822

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IBA:GO_Central

GO - Biological Function
beta-catenin binding	GO:0008013	IEA:InterPro
transcription coactivator activity	GO:0003713	IBA:GO_Central
transcription factor binding	GO:0008134	ISO:RGD

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP04105
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.80|      24|      27|     763|     786|       1
---------------------------------------------------------------------------
  763-  786 (39.02/29.48)	VLTCL...KGQDE..QREGLLTSLQNQVN
  788-  816 (30.78/21.35)	ILSNWreeRYQDDtkARQMMHEALQLRLN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.62|      14|      27|     414|     429|       2
---------------------------------------------------------------------------
  414-  429 (23.57/19.58)	PGARMTCRllLHLFRA
  444-  457 (27.04/15.86)	PGIRSSCD..RHLLAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.17|      16|      27|     155|     171|       3
---------------------------------------------------------------------------
  155-  171 (22.97/14.00)	LLLKSSSLAGSYtTGLC
  185-  200 (29.21/14.11)	LILNPDQTAQVF.EGLC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.04|      19|      27|     832|     852|       4
---------------------------------------------------------------------------
  832-  852 (27.73/27.81)	TTdwALLLLQIITSGTV..DMHT
  858-  878 (27.31/17.63)	TT..VLDMLGVLINGTLasDLST
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      79.44|      24|      27|     288|     312|       5
---------------------------------------------------------------------------
  288-  312 (40.37/31.22)	GKVlND..NAANRYSFVCNTLMNVCMG
  317-  342 (39.07/25.17)	GRI.NDiaNFSSELTACCTVLSSEWLG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.29|      12|      30|      23|      34|       6
---------------------------------------------------------------------------
   23-   34 (22.36/13.94)	GVGKERDEARHQ
   55-   66 (21.93/13.54)	GVGDEGQKARKN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      98.02|      28|     101|     998|    1048|       7
---------------------------------------------------------------------------
 1015- 1043 (48.11/62.81)	YYLEPLPLPPEEEEEEPTSP.......VSQePERKS
 1082- 1116 (49.91/16.07)	YRLPPNYSPMSSQMMHHTQPalwgynlVSQ.PQQPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      74.74|      25|      30|     666|     692|       8
---------------------------------------------------------------------------
  666-  692 (36.23/30.48)	SSS...GMSLFNPnTIGSVdPSSTRQNGIK
  696-  723 (38.51/22.42)	SSSerrGVWLVAP.LIARL.PTSVQGRVLK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.88|      22|      30|     210|     234|      10
---------------------------------------------------------------------------
  210-  234 (33.96/35.88)	SECSSPERCIlaYlYDLYVSCSHLR
  243-  264 (36.92/25.82)	SACSKVKQTI..Y.NNVMPANSNLR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     125.80|      39|     270|     615|     654|      14
---------------------------------------------------------------------------
  615-  654 (60.89/47.38)	RQSWLELQLMIKQCLKDPSSGSVAEMNNLLDnIAKATIEV
  888-  926 (64.90/45.46)	KRAYMNLVKKLKKELGDKRSESIDKVRQLLP.LPKQTCDV
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP04105 with Med12 domain of Kingdom Metazoa
Unable to open file!