<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04093

Description Mediator complex subunit 12-like (Fragment)
SequenceQQQQQQQRLLRQAQTRPFQQFPRQGLQQTQQQQQTAALVRQLQKQLSSNQPQQGVTPCAHPSHF
Length64
PositionKinase
OrganismRattus norvegicus (Rat)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae> Murinae> Rattus.
Aromaticity0.05
Grand average of hydropathy-1.383
Instability index85.34
Isoelectric point12.00
Molecular weight7490.24
Publications
PubMed=15057822

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IBA:GO_Central
GO - Biological Function
transcription coactivator activity	GO:0003713	IBA:GO_Central
transcription factor binding	GO:0008134	ISO:RGD
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP04093
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      88.81|      25|      26|       1|      25|       1
---------------------------------------------------------------------------
    1-   25 (48.15/14.06)	QQQQQQQR...LLRQAQTRPFQQFPRQG
   27-   54 (40.67/10.63)	QQTQQQQQtaaLVRQLQKQLSSNQPQQG
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP04093 with Med12 domain of Kingdom Metazoa

Intrinsically Disordered Regions

IDR SequenceStartStop
NANANA

Molecular Recognition Features

MoRF SequenceStartStop
1) QQQQQQQRLLRQAQTRPFQQFPRQGLQQTQQQQQTAALVRQLQKQLSSNQPQQGVTPCAHPSHF
1
64