<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04090
| Description |
Putative transcription mediator subunit med12 |
| Sequence | MLSYLTLQAHVHDAANKASNETVYLIHRVFDVALILVDTLSDEIRQQCVRILREALSDSRLRYIFSSTPAPLDNLMLSHKDKPATSQQTQSQGSQGSQQGQQQRPRGAGFLGVGAAGGNIWGNAVGPGGQGQEKLSTFTFKRWEILNEPTSNVGENNTSLSLTLFEAIKLH |
| Length | 171 |
| Position | Kinase |
| Organism | Diaporthe ampelina |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Diaporthales> Diaporthaceae> Diaporthe.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.362 |
| Instability index | 44.91 |
| Isoelectric point | 6.97 |
| Molecular weight | 18704.76 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP04090
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.66| 14| 20| 96| 109| 2
---------------------------------------------------------------------------
96- 109 (26.08/13.90) GSQQGQQQRPRGAG
118- 131 (27.58/15.04) GNIWGNAVGPGGQG
---------------------------------------------------------------------------
|