Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MASSQAPPAAPSEDQDAKSRETKYGGYTRFEIELEFVQSLANPNYLNHLAAQKLLQQPAFVQYLKYLQYWSRPPYLKYLTYPGPTLKNLELLQQERFRRDIISPDFVAALIQEGTKSAVEWHKEKGV |
Length | 127 |
Position | Middle |
Organism | Diaporthe ampelina |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Diaporthales> Diaporthaceae> Diaporthe. |
Aromaticity | 0.13 |
Grand average of hydropathy | -0.613 |
Instability index | 60.39 |
Isoelectric point | 7.90 |
Molecular weight | 14665.45 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:EnsemblFungi |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | DNA repair GO:0006281 IEA:EnsemblFungi meiotic gene conversion GO:0006311 IEA:EnsemblFungi meiotic sister chromatid segregation GO:0045144 IEA:EnsemblFungi regulation of transcription, DNA-templated GO:0006355 IEA:InterPro transcription by RNA polymerase II GO:0006366 IEA:EnsemblFungi |
Binary Interactions |
Repeats | >MDP04081 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 60.92| 16| 28| 34| 49| 1 --------------------------------------------------------------------------- 34- 49 (28.86/14.56) LEFVQSLANPNYLNHL 64- 79 (32.06/16.74) LKYLQYWSRPPYLKYL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ETKYGGYTRFEIE 2) PYLKYLTYP 3) YLQYW | 21 74 66 | 33 82 70 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab