<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04078

Description Mediator of RNA polymerase II transcription subunit 4
SequenceMDRIVDVRFERVEKALATLVESITKYNPQASQAVELANADSELGHGLKQLETHQNNYRRLESLKASSSALDAQIRDTIRTLWTTRKDITSTSTTAAPDGPQYDVNYEELLSYARRISKMTLPPASILSRIDAANPESAASTGEAVNTPNTTAAPTPAAGGSTPNPNAASNGAPTPAAQPQSQGQQGTQTTANSGATALPEEWTQFLDPLTGHVFLPWATEDKIRVGALASIQNLVEEGIDPRGYDPAEEEVRRQKEEQERREQEEREALEREENLKKMREEQARIARERQRERERLQDEALRRGSTGGEGPSPSGAAASNEPQKKQFQFMGGDLDDDDDD
Length340
PositionMiddle
OrganismDiaporthe ampelina
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Diaporthales> Diaporthaceae> Diaporthe.
Aromaticity0.04
Grand average of hydropathy-0.941
Instability index49.87
Isoelectric point4.79
Molecular weight37337.32
Publications

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP04078
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.23|      17|      17|     142|     158|       1
---------------------------------------------------------------------------
  142-  158 (32.17/19.76)	GEAVNTPN..TTAAPTPAA
  159-  177 (29.05/17.09)	GGSTPNPNaaSNGAPTPAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     107.59|      30|     118|     182|     211|       2
---------------------------------------------------------------------------
  182-  211 (53.40/29.61)	QGQQGTQTTANSGATALPEEWTQFLDPLTG
  303-  332 (54.19/30.15)	RGSTGGEGPSPSGAAASNEPQKKQFQFMGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.27|      22|      25|     248|     272|       3
---------------------------------------------------------------------------
  248-  269 (36.66/23.46)	EEEVRRQKEEQERREQEEREAL
  280-  301 (36.61/15.86)	EEQARIARERQRERERLQDEAL
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP04078 with Med4 domain of Kingdom Fungi

Unable to open file!