| Description | Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MTSFTTALPTPAHSINGTTLPSDSTVDISMSGESPHKRKRVQEDVGEQSQNQKRVHMDDGLPALKDMHEDVGEKYLVLQKSWQPARPLLSEDVFEMYDLTSLAGEVARVLPDGTKNAMRKTYKGQIKKLGLMGHFDPVKKEPNDPDGILSLLSVPAEEFTVHFVRGREIEDGFRPEVQKVLKQATTMARGTISSKKWDQGALGDFAGGSKGPASAKATAPGTPMHPALAGIPRTKAQSVAAQEAARPRRANKKRSYGDSSFEGYGEVYDDETGAETGYSTGEGEGTKRRKKNAKSFQQIGTPRQSYGPGMVGV |
| Length | 313 |
| Position | Head |
| Organism | Diaporthe ampelina |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Diaporthales> Diaporthaceae> Diaporthe. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.744 |
| Instability index | 48.95 |
| Isoelectric point | 8.99 |
| Molecular weight | 33963.77 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP04075
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 125.99| 37| 72| 105| 142| 1
---------------------------------------------------------------------------
105- 142 (61.14/42.17) EVARVLPDGTKNAmRKTYKGQIKKLGLMGHFDPVKKEP
176- 212 (64.85/40.05) EVQKVLKQATTMA.RGTISSKKWDQGALGDFAGGSKGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.16| 18| 24| 39| 62| 2
---------------------------------------------------------------------------
28- 48 (27.20/23.69) ISMSGESPhkrKRVQEDVGEQ
55- 74 (29.96/12.26) VHMDDGLP.alKDMHEDVGEK
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) GTKRRKKNAKSFQQIGTPRQS 2) YGEVYD | 285 264 | 305 269 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab