<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04074
| Description |
Putative transcription mediator subunit med12 |
| Sequence | MGVPQRQPPSRSLSGSSTLSQRPAHQRTLSSQYIPSSPIRNNNNNSTNSNSSISADFAADASSQNSNATQTQYGTPRRGGSRLRLELSNQGIAHSGFIESPTSAGPLDPFKSFASSRPAAPSMSGDVSDLGDMSSPQTSRGAPTVDNDNNPLPMPRRRTRFVVPDARKDVAAPAPAPVKKDIRPKPYTVEVPSAAPRYLVLNSSGKADSSSRIGATNAPPTAHADFNPWTGDGPEDHFTQTFIQTGFFDKAPVAQVETSSAKGLIFPSLKHKSGLYALSTVFTGILGSRRHNGQINSASTFKPPPRVTVTDTKREGWLRDLANPTTSLRRLSRTIPHGIRGKGLLEQCLNKNIPTDRAVWLAKCVGANEVRAFKRKGVNGAVVMGGEAKWVRDWTMFVEQFVDGVVSAFEDAEWKTKVNYA |
| Length | 421 |
| Position | Kinase |
| Organism | Diaporthe ampelina |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Diaporthales> Diaporthaceae> Diaporthe.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.586 |
| Instability index | 48.29 |
| Isoelectric point | 10.12 |
| Molecular weight | 45411.24 |
| Publications | |
Function
| Annotated function |
Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.
Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04074
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 191.15| 42| 74| 109| 151| 1
---------------------------------------------------------------------------
46- 71 (24.59/ 7.07) .......STN.SNSS.ISADFA..ADASS.QNSNAT.QT.......
73- 106 (41.65/16.62) ....YGTPRR.GGSR.LRLELSNQGIAHSGFIE..S.PTSAGP...
109- 151 (68.93/35.87) PfKSFASSRP.AAPS.MSGDVSDLGDMSSPQTSRGA.PTVDNDNNP
184- 228 (55.99/24.86) P.KPYTVEVPsAAPRyLVLNSSGKADSSSRIGATNApPTAHADFNP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.52| 17| 148| 153| 173| 2
---------------------------------------------------------------------------
153- 173 (27.59/22.76) PMPrrrtRFVVPDAR.....KDVAAP
303- 324 (26.92/12.90) PPP....RVTVTDTKregwlRDLANP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.89| 10| 14| 5| 14| 3
---------------------------------------------------------------------------
5- 14 (18.97/ 9.72) QRQPPSRSLS
21- 30 (18.91/ 9.66) QRPAHQRTLS
---------------------------------------------------------------------------
|