Description | Putative transcription mediator subunit med12 |
Sequence | MGVPQRQPPSRSLSGSSTLSQRPAHQRTLSSQYIPSSPIRNNNNNSTNSNSSISADFAADASSQNSNATQTQYGTPRRGGSRLRLELSNQGIAHSGFIESPTSAGPLDPFKSFASSRPAAPSMSGDVSDLGDMSSPQTSRGAPTVDNDNNPLPMPRRRTRFVVPDARKDVAAPAPAPVKKDIRPKPYTVEVPSAAPRYLVLNSSGKADSSSRIGATNAPPTAHADFNPWTGDGPEDHFTQTFIQTGFFDKAPVAQVETSSAKGLIFPSLKHKSGLYALSTVFTGILGSRRHNGQINSASTFKPPPRVTVTDTKREGWLRDLANPTTSLRRLSRTIPHGIRGKGLLEQCLNKNIPTDRAVWLAKCVGANEVRAFKRKGVNGAVVMGGEAKWVRDWTMFVEQFVDGVVSAFEDAEWKTKVNYA |
Length | 421 |
Position | Kinase |
Organism | Diaporthe ampelina |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Diaporthales> Diaporthaceae> Diaporthe. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.586 |
Instability index | 48.29 |
Isoelectric point | 10.12 |
Molecular weight | 45411.24 |
Publications |
Annotated function |
Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.
Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.
ECO:0000256 ARBA:ARBA00002895 ECO:0000256 ARBA:ARBA00003744 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP04074 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 4| 191.15| 42| 74| 109| 151| 1 --------------------------------------------------------------------------- 46- 71 (24.59/ 7.07) .......STN.SNSS.ISADFA..ADASS.QNSNAT.QT....... 73- 106 (41.65/16.62) ....YGTPRR.GGSR.LRLELSNQGIAHSGFIE..S.PTSAGP... 109- 151 (68.93/35.87) PfKSFASSRP.AAPS.MSGDVSDLGDMSSPQTSRGA.PTVDNDNNP 184- 228 (55.99/24.86) P.KPYTVEVPsAAPRyLVLNSSGKADSSSRIGATNApPTAHADFNP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 54.52| 17| 148| 153| 173| 2 --------------------------------------------------------------------------- 153- 173 (27.59/22.76) PMPrrrtRFVVPDAR.....KDVAAP 303- 324 (26.92/12.90) PPP....RVTVTDTKregwlRDLANP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 37.89| 10| 14| 5| 14| 3 --------------------------------------------------------------------------- 5- 14 (18.97/ 9.72) QRQPPSRSLS 21- 30 (18.91/ 9.66) QRPAHQRTLS --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KKDIRPKPYTV 2) RRRTRFVVPDARKDVAAP | 179 156 | 189 173 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab