<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04065

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMDSGGQNGALSDHHKDSAVNGINGVKSIDGPRVAPDKGKAPATTTANNGSNAVNGGGAEGEARSNSPTEQVSRMNNLPDEIVHITQGFVPLSLLLTRLAQSTHNMLQDKIAELAKLPLPAAATNGTTNYTQSAPDDTSGENLRKKAMLLHFIQDMHAKWVKALVIVEWSRKASMVSKLIDLKFHLDQQRILYDTALDSIINVKRDLTYARMPSPDLKTALQVLSTGTAPWMPDLQYIEPPPLTTEEQLRGIGDLDTLLSLRLNLDDFDKIPHQFRNYTIGSGRVTFKVAGEFEVDLTIADEDFEKQFWFIDFRFAFRPAALSLPESLRTPLENCVNEALAKDGLAGCYQFLHEYVLTTKINELKRQALQLSRTSWTGTLAVEPLNRALSIQYWTSRSPATGLKNWIIVAVNSGRKQGGRTDPKASSFLAAKWYRDGKEVKDVEIEVNTENLSAESLLKDVVGRHIEHILSNIHSGLLAAPRFKNRETGVVLNISKTDPVASCLNLQVGYGGTVSLLIEPTSGAFAMKPHSKFSIQPELQLNNGKNPTEDGVNFLEHLRCAIIEDELGRMGTARGWSVRKAPVNVDELRSITKMRRWSRTIWLQHGGWGSTWFVGVILSLEGDEWWLLETDITQTNGVSKFHTKLPLNKGTPHMSGSFWDNLNLFAGGMITQSVDMRELHRRRVKCQSNGSIDLSLPQQVRMPSIEVALSAIFPTVTQEDADEVKSQHHSAFGLNEDPQVLALLRLKAGISPEAREPWAENMVAINFKGVHSESRREETGEGGYTTTHELVCTSDVVIRVRRPTRFLDLKGVVDRNVSYNPQRGEFILQVQRRVTEPVFDILKSRIKAIDRFVNFLEAMENAKGSIISESITLKGVVFCYSSPLPAPPDGETAAPSPARELWRVKMDLSSEDIDIHMEKDNPHVRVIDLARNLASTEGGIGLLMAWLPMSLHAMKALVQLDAQWTELFRKGQGRLDFSMKSMTWINLKYKDLATGQPGDKTKRSISIDVKMKARRGEGWWHAWRSTTNAAPDDFDQALKAVWEGKGNNWLGLTSGAAAQSNEAVMDMLLAIDAAIRGVVHASPSLPPGGVKAEVITLD
Length1097
PositionTail
OrganismTrichoderma harzianum (Hypocrea lixii)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Hypocreaceae> Trichoderma.
Aromaticity0.07
Grand average of hydropathy-0.316
Instability index42.40
Isoelectric point6.65
Molecular weight121557.99
Publications
PubMed=26067977

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU365082
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP04065
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.60|      12|      15|     638|     649|       1
---------------------------------------------------------------------------
  638-  649 (21.55/13.24)	SKFHTKLPLNKG
  655-  666 (23.05/14.71)	GSFWDNLNLFAG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     294.98|     107|     300|     489|     601|       2
---------------------------------------------------------------------------
  489-  560 (96.97/58.08)	...........................................................................................................................................................................................................................................VVLNISKTDPVASCLNLQ...VGYGGTVSLLIEPTSGAF.AMKPHSKFSiQPELQLNNGKNPTEDG.VNFLEHLRCA
  561-  601 (27.04/19.11)	IIEDELGRMGTARGWSVR.KAPVNVDelrsiTKMRRWSRTIW..............................................................................................................................................................................................................................................................................
  795-  861 (82.56/44.82)	..........................................lqhggwgstwfvgvilslegdewwlletditqtngvskfhtklplnkgtphmsgsfwdnlnlfaggmitqsvdmrelhrrrvkcqsngsidlslpqqvrmpsievalsaifptvtqedadevksqhhsafglnedpqvlallrlkagispearepwaenmvainfkgvhsesrreetgeggyttthelvctsdVVIRVRR..P.TRFLDLK...GVVDRNVS..YNPQRGEF.ILQVQRRVT.EPVFDILKSRIKAIDRfVNFLEAMENA
  865-  954 (88.41/49.65)	IISESITLKGVVFCYSSPlPAPPDGE.....TAAPSPARELW.......................................................................................................................................................................................rvkmdlssedIDIHMEKDNPHVRVIDLArnlASTEGGIGLLMAWLPMSLhAMK..................................
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      72.75|      20|      77|     230|     249|       3
---------------------------------------------------------------------------
  230-  249 (39.50/28.51)	WMPDLQY.IEPPPLTTEEQLR
  308-  328 (33.25/22.64)	WFIDFRFaFRPAALSLPESLR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.28|      12|      19|     748|     759|       4
---------------------------------------------------------------------------
  748-  759 (23.39/12.73)	GISPEA.REPWAE
  768-  780 (16.89/ 7.28)	GVHSESrREETGE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      78.61|      21|      23|    1016|    1036|       5
---------------------------------------------------------------------------
 1016- 1036 (42.24/28.26)	EGWWHAWRSTTNAAPDDFDQA
 1042- 1062 (36.37/23.12)	EGKGNNWLGLTSGAAAQSNEA
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP04065 with Med14 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MDSGGQNGALSDHHKDSAVNGINGVKSIDGPRVAPDKGKAPATTTANNGSNAVNGGGAEGEARSNSPTEQVSRMNNL
1
77










Molecular Recognition Features






MoRF SequenceStartStop




NANANA