<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04057

Description Mediator of RNA polymerase II transcription subunit 6
SequenceMANPNDPPLDEIQWRSPQIVAQMGGLHSNTILFYFAESPFFERTSNNAVIMAQAMNNMAMYHYIQTREAFETRLKTMSGLEFIVGEEPAETGPGMGTGVWVIRKQTRRKRYQDDDEITVHASFFVVGENIYMAPTLADILASRIMTISSAIAKALPAAEAARKWRPSTGHVYQLPASQSSTQPKPQESKDEKPVLDEAGKPLSAVAKHDAPFMDRVAEESFMIHLRYGGEYIDEIPITGKPGEFHLSSTGRKPVLPPQGAAPTGISAMSGPPMLNTKLDDKKDGRPDKTPKSATMPKLKRKKSKMSPSVTPAATPGAS
Length318
PositionHead
OrganismTrichoderma harzianum (Hypocrea lixii)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Hypocreaceae> Trichoderma.
Aromaticity0.07
Grand average of hydropathy-0.489
Instability index52.99
Isoelectric point8.86
Molecular weight34857.45
Publications
PubMed=26067977

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364143
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP04057
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      80.31|      24|     147|      68|      94|       1
---------------------------------------------------------------------------
   68-   94 (34.10/33.39)	EAFETRLKtmSGLEFIvGEEPAETGPG
  219-  242 (46.21/31.27)	ESFMIHLR..YGGEYI.DEIPITGKPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.10|      12|      17|     155|     170|       2
---------------------------------------------------------------------------
  155-  166 (22.30/17.33)	LPAAEAARKWRP
  174-  185 (21.80/ 6.19)	LPASQSSTQPKP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      93.64|      26|      58|     188|     213|       3
---------------------------------------------------------------------------
  188-  213 (45.23/22.59)	SKDEKPVLDEAGKPLSAVAKHDAPFM
  248-  273 (48.41/24.63)	STGRKPVLPPQGAAPTGISAMSGPPM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.83|      17|      17|     278|     294|       4
---------------------------------------------------------------------------
  278-  294 (29.11/17.49)	LDDKKDGRPDKTPKSAT
  298-  314 (27.72/16.31)	LKRKKSKMSPSVTPAAT
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP04057 with Med6 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) TGHVYQLPASQSSTQPKPQESKDEKPVLDEAGKPLSAVAKHD
2) TGKPGEFHLSSTGRKPVLPPQGAAPTGISAMSGPPMLNTKLDDKKDGRPDKTPKSATMPKLKRKKSKMSPSVTPAATPGAS
168
238
209
318










Molecular Recognition Features






MoRF SequenceStartStop




1) TKLDDKKDGRPDKTPKSATMPKLKRKKSKMSPSVTPAATPGA
276
317