<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04039
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MSALSQDQIKTLDQSRHRLVQLTRSLGSLITSLNQSDPLPSCHAVLRGRVPAPEFPSRTQSSTSTSTSTSTLEQLLRTKLDPRVEDWVSRGRRADASETEERRKAQQQLQLGESELAALWRWAPVEANHEARRRNWGGDFTLEERERGVQVVAGELGLWRGLEDDESSDEEEEEEEEEEEDEDEDEDGEMEVVGVRKSASGSGLEYDIAAATAGSLHDRMVAPLVPLEEILRYMTTGVPPGQR |
| Length | 243 |
| Position | Head |
| Organism | Aspergillus rambellii |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.840 |
| Instability index | 82.23 |
| Isoelectric point | 4.56 |
| Molecular weight | 27181.41 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04039
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 161.21| 40| 41| 90| 130| 1
---------------------------------------------------------------------------
47- 85 (58.08/30.90) RG.RVPAPEFPSRTQSSTSTSTSTSTLEQLLR.TKLDPRVE
90- 130 (61.65/38.26) RGRRADASETEERRKAQQQLQLGESELAALWRwAPVEANHE
132- 160 (41.48/19.85) RRRNWGGDFTLEERERGVQVVAG..EL.GLWR.........
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.53| 13| 14| 163| 175| 2
---------------------------------------------------------------------------
163- 175 (22.61/11.76) EDDESSDEEEEEE
179- 191 (23.93/12.88) EEDEDEDEDGEME
---------------------------------------------------------------------------
|