<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04035
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSNRASSASFRVGPPSPSSPAAFSLKENSLTASPPGQIPQTPTSPPLMSGSASKNASSFASLQASPSQATSQPANLSSPPSSTPMSTQASQQPTAGMTNSFPTPASSVDPDHIDKSFGASVSEIGAPSAASTSAAPSQQSEHRRTDHDRNFEGSQATTGVRDLANMASSTQAHHGDAMDIDTDNPNWPSLDSLQRDFSSAFHLCKSSHIATGPDPTLDLISLYGLGPVAKSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPVKIDSTTAGGLRHMTMWPEEEWQNQKVYGKEIKVADIDSALYNLQMKAMKMESGTVPNNDYWEDVLGHEKPAKHVSNGEVAKKVAAAPNGVRVPTQTNGSSAPTDQERSRPSRGRKRHYDDNSFVGYGEGYADDDDDGAYYSNGEGVGKKKRKKDHVSKISTPLPERGGSYGVGMFGIGAR |
| Length | 446 |
| Position | Head |
| Organism | Aspergillus rambellii |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.757 |
| Instability index | 47.52 |
| Isoelectric point | 7.82 |
| Molecular weight | 47305.59 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04035
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 145.00| 25| 26| 39| 63| 1
---------------------------------------------------------------------------
14- 35 (35.42/15.52) PPSPSSPAAFS..LKEN.SLTASPP
39- 63 (45.72/22.19) PQTPTSPPLMSGSASKNASSFASLQ
66- 88 (38.19/17.31) PSQATSQP..ANLSSPPSSTPMSTQ
90- 107 (25.67/ 9.20) SQQPTAG..MTNSFPTPASS.....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 118.01| 29| 31| 114| 142| 2
---------------------------------------------------------------------------
111- 140 (43.16/21.78) DH....iDKSFGASVSEIGAPSAAS.....TSAAPSQQS
141- 172 (36.35/17.22) EHrrtdhDRNFEGSQATTGVRDLA.......NMASSTQA
173- 206 (38.50/18.65) HH....gD.AMDIDTDNPNWPSLDSlqrdfSSAFHLCKS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 96.87| 31| 37| 264| 296| 4
---------------------------------------------------------------------------
264- 296 (54.57/48.35) KPVKIDSTTAG.GLRHMTM....WPEEE.WQNqkVYGKE
298- 334 (42.30/30.18) KVADIDSALYNlQMKAMKMesgtVPNNDyWED..VLGHE
---------------------------------------------------------------------------
|