<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04028
| Description |
Uncharacterized protein |
| Sequence | MADILTQLQTCLDQLATQFYATLGYLSTYHDNSPAIPPPGIPNAAPALARMSKNTTSPPVPASIAASAGAGAAAAGAAQSPVPPPTQQPGTEPGAAEGEDPSLLPQPDSPRTFAARQRELARDLIIKEQQIEYLISVLPGIGASEAEQEARIRELETQLREVEKERVAKAEELTQLRGRLENVLDAVSVGLYGDR |
| Length | 195 |
| Position | Middle |
| Organism | Penicillium brasilianum |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.331 |
| Instability index | 56.74 |
| Isoelectric point | 4.67 |
| Molecular weight | 20645.94 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP04028
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 89.82| 19| 20| 73| 91| 1
---------------------------------------------------------------------------
51- 69 (25.93/ 8.30) MSKNTTSPPVPASIAASAG
73- 91 (34.14/12.81) AAAGAAQSPVPPPTQQPGT
95- 112 (29.75/10.40) AAEGEDPSLLPQP.DSPRT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.30| 13| 15| 147| 160| 2
---------------------------------------------------------------------------
147- 160 (18.33/15.89) EQEARIRELeTQLR
165- 177 (21.97/13.75) ERVAKAEEL.TQLR
---------------------------------------------------------------------------
|