<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04000
Description |
Related to NUT2-subunit of the RNA polymerase II mediator complex |
Sequence | MASAAGNPRQITPTSPSPSPEPQQGATNGSSSTTAPPPASTPLHPPSHDPSSTTAPTDPTEAVRAKLETRLRSVVDLLYQLAVCSADVQEGSEDLVANKLNECIQALAALDATKDEVHRAHMMVPQDILELLDTGKNPDIHTRNFVNRLASENQYSYGQHKVVQSYLNRLDAALDQAFPELAQDRNESEGKTE |
Length | 193 |
Position | Middle |
Organism | Sporisorium scitamineum |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina>
Ustilaginomycetes> Ustilaginales> Ustilaginaceae> Sporisorium.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.644 |
Instability index | 50.68 |
Isoelectric point | 4.90 |
Molecular weight | 20790.67 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP04000
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.45| 19| 19| 18| 36| 1
---------------------------------------------------------------------------
18- 36 (36.26/17.29) PSPEPQQGATNGSSSTTAP
38- 56 (38.19/18.56) PASTPLHPPSHDPSSTTAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.40| 12| 20| 107| 118| 2
---------------------------------------------------------------------------
107- 118 (19.82/14.34) LAALDATKD.EVH
129- 141 (16.57/10.91) LELLDTGKNpDIH
---------------------------------------------------------------------------
|