<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03999
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MNGEHEGDGVDRQDDGAVAGTSRSFFPPPPQVYKKFTKRNLRYLEVLNSHKVADGEPSWEQLTAEQRLERQNDILRQHRSSSRTNAQQQDEDINMASVEEDTGATTVDDLPDFDLKAELEPPNVDWIEEDGGYTVFGQLWPIPDTAPTLEQLGIPVLYPLEGTNRKELLLALLRTLLQTYRKIIADLLKPAQPYDVWVPAVPDPNLTPEQQQQQMATNPGFWTQSTEAKDRLKHMQNVVVNMQFLINELRPVQAKETLKLIMQMQLERRQQETRLIRERCASMHSRVQELKSMLAKQKTEE |
Length | 301 |
Position | Middle |
Organism | Sporisorium scitamineum |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina>
Ustilaginomycetes> Ustilaginales> Ustilaginaceae> Sporisorium.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.763 |
Instability index | 49.16 |
Isoelectric point | 5.05 |
Molecular weight | 34610.63 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP03999
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.16| 15| 15| 152| 166| 1
---------------------------------------------------------------------------
152- 166 (26.60/14.97) LGIPVLYPLEGTNRK
168- 182 (21.56/10.94) LLLALLRTLLQTYRK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.23| 20| 27| 91| 110| 5
---------------------------------------------------------------------------
91- 110 (34.10/24.44) EDINMASVEEDTGATTVDDL
120- 139 (39.13/29.05) EPPNVDWIEEDGGYTVFGQL
---------------------------------------------------------------------------
|