<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03987
Description |
Cyclin-dependent kinase |
Sequence | MFGRSFPFANSLGAPYLRGNFPSWYLSHRWFKAEERGHVGVYLPDTADSKKTSGSVYTSKVHVREKYHIVGFISSGTYGRVYKAIGRNGQKGEFAIKKFKPDKEGELIQYTGLSQSAIREMALCSELNHANVVQLVEIILEDKCIFMVFEYTEHDLLQIIHHHTQPQRHAIPAPMVRSILFQLLNGLLYLHSNWVLHRDLKPANILVTSNGHIRIGDLGLARLFYKPLNSLFSGDKVVVTIWYRAPELLLGSRHYTPAVDLWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMMKIIEILGLPRKENWPGLVWMPEYPQLQSLAMSRGPGHFNKPSNLEGWYQACLKNSGYGPNSSAGTPGADGFDLLSRLLEYDPAKRITAQEALEHPYFKNGGPISANCFEGYEGKYPHRRVSQDDNDIRTGSLPGTKRSGLPDDSLMGRASKRLKE |
Length | 454 |
Position | Kinase |
Organism | Rasamsonia emersonii CBS 393.64 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Trichocomaceae> Rasamsonia.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.367 |
Instability index | 40.87 |
Isoelectric point | 9.27 |
Molecular weight | 51278.22 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
cyclin-dependent protein serine/threonine kinase activity GO:0004693 IEA:UniProtKB-EC
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP03987
No repeats found
|