<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03986
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MPITGVFFIPSTPNAPNALATLSERLRSSYGDEAVPVGRWALEHKLMRDTSSCLPASAHAPNPPPQPRYMQFLSLSHYPNHGFIYASESTDQPDTNAPGLAQQPPRKPSTQSGMIMSTIPLPSCSTLFQHFVRACEPLWCHRHTVTAGGTTYDVGDFRVRIGEVRQTQPMARARGTVVEIEWRGPSIASSPLLSPLPTDGDGSGDYADSAVDLSFIPEDSDIDAEYAQTAELIREFWSRFGVTDKGVQEAILVPDVGRELKAKLHQRRQSGWRELEAKRRQKKNEAAALGRSWGWGWNEQDDDPDAGVDLARQYMEIFRFNR |
| Length | 322 |
| Position | Head |
| Organism | Rasamsonia emersonii CBS 393.64 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Trichocomaceae> Rasamsonia.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.563 |
| Instability index | 58.97 |
| Isoelectric point | 5.79 |
| Molecular weight | 35849.71 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP03986
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.37| 18| 23| 189| 210| 1
---------------------------------------------------------------------------
193- 210 (33.94/27.92) LSPLPTDGDGSGDYADSA
213- 230 (32.43/15.61) LSFIPEDSDIDAEYAQTA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.00| 13| 23| 262| 274| 2
---------------------------------------------------------------------------
262- 274 (25.06/14.09) AKLHQRRQSGWRE
287- 299 (27.94/16.49) AALGRSWGWGWNE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.24| 17| 40| 63| 79| 5
---------------------------------------------------------------------------
63- 79 (34.89/18.79) PPPQPRYMQFLSLSHYP
104- 120 (32.35/16.96) PPRKPSTQSGMIMSTIP
---------------------------------------------------------------------------
|