<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03975
| Description |
RNA polymerase II Mediator complex subunit Sin4 (Fragment) |
| Sequence | SWRRASTSTTSSGILPPSNWVSLHHNPPRVSHSVSMRCASWAAVSMLSLFLLYSTTIIESRAGSDQLLGRKLAWSRLGCIAYISQDGHRVHVRHLVCRPSDGKWVLSNDHPLNPVTEAHGGHTLTHLSWNETGSELAVVDASGRVSVFSISIALNSIVTHRQAIIDSADDGSQVVGMMWLNAQRSVGFLVPFVLKAC |
| Length | 197 |
| Position | Tail |
| Organism | Rasamsonia emersonii CBS 393.64 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Trichocomaceae> Rasamsonia.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | 0.047 |
| Instability index | 33.41 |
| Isoelectric point | 9.16 |
| Molecular weight | 21460.20 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP03975
No repeats found
|