<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03972

Description Mediator of RNA polymerase II transcription subunit 13
SequenceMDFLKTCTTNIHVVEDLAETALLLYRLRDERAGSTQKLKEARNAVSHLRREKVLCAIVEQDIYIFGDVSPEHTLELEDRYELVEEGTVGSQDETTSVNTKDIFLDAVEHAIAFSLAADSAITYVASWTWLYHDAEAENGSDADSGSIIKMHAEYTPTAALLLVPEILPASWLPIGHADEQVESHIILAPRGIPARRIAEARRKVWSDNAWKVNVSEALELDAIRTDNDTVWISVELQDSAGLCCLWPAELCLAPATATNLEFCAMTRRSDWRRWLVGLEEEDAFRNPLAVAEEWFKGAGEREQAVQNAVKASTSDPHSSQTHVSTAANDEEAMTSPPFMQRALDQQTAVSGIYPTPPDGMAQAPQTAHMNLGATPSVAHTDNTMSGVEMTSNTNDHAQSNGSDPDQSLDREDFELNQEDLFGDNSGGIEFGEDAVDDADFNFFDEPDDEPEQGTVASTEMDDESTHEHELEPVIAQDTVNELQPTSDDISTAAAVDSAVSEHLTLPTSDDTAGENVLTAGSDESRFATHTSEPEKALSPFGIRERLLPPPVPASLANTDSNDFARFRRHSTFAPIVFKNSFNLGPKYADTGLVDDEAQRPMIKSKIPNINLPPVKKKSRLLRQEVNMEPRMMDPNSESEEDSYESASSDSDDELPPKLPWDTRKRKRPSDEDRLQPLASSMERMLSDDDPGDDSETTESQHNADTMLEKCLTRASDGGMAVSLRNSSDNYSDCGPKNASDEESGDSSMRKVEELYSLRKEDLIYVAQIVHEQAMSMTRSSVAEQDLFSNGGSDPEKAQCGRISIAKAVESVFPDAAICDLVQLAATRDQAPRPTVPVKTPQGQPRMPQRSDSQIVLGPDYFPLPSPYVRIQRGADNWEMMSTCLSFWETLGLGPTNGPKNVRAFCVFPFNEDLQHLVAQFIGELGTSYENCKLGSYVHLRNVSDASLDSFEDGMAPVEVNEEEESVEGLLKAYATTCAELGKVLSTIGHEESDRTIVVYMLNPFSGRQALQHLCACFWVLFKAYRDNVPKALRNQCGSDIVLQVLPIKLVASFDELVVPEAKEIALLAREVYDRCPPSVSHNSETLSALPILAAPSVELANAAPKRIGFQLAAEPPSDLLHEGSILHLAYACSQDGHWLTVAWIDNTGQHQSTASFCLRGKTFSEVAEGVWDRTREILAARQVTWRVFIVTPDAMDTSLSHCWRSITSRRRPYPLCVTLLSVQLDPILHLSPPAVPLDTQFTWPTADGGFLTPASTPQAGNLTSSPNPGGDSTAPPTPAPSETMTAASIAENDPDAHLTDLTDETWGVLLSPKLAPFTSPFPGQANGALFRRGDPSPGEALPSLGVSVHWTIQVKPSGGVDDGSVKQAELTCREVLKMYRGLSVLTKARGLDGGRRGTEWVAPVHVAMVVRGVEGLEGFLEKDEKGES
Length1428
PositionKinase
OrganismZymoseptoria brevis
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Zymoseptoria.
Aromaticity0.06
Grand average of hydropathy-0.409
Instability index47.50
Isoelectric point4.58
Molecular weight156286.13
Publications









Function






Annotated function

Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.



GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP03972
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     260.08|      53|      60|    1232|    1284|       1
---------------------------------------------------------------------------
  655-  706 (87.81/38.16)	PPKLPWD.TRKRKRPSDEDRLQPLASSM.ERMLSDDDPGDDSETTESQHNADTM
 1232- 1284 (97.10/42.94)	PPAVPLD.TQFTWPTADGGFLTPASTPQAGNLTSSPNPGGDSTAPPTPAPSETM
 1294- 1341 (75.17/31.67)	PDAHLTDlTDETWGVLLSPKLAPFTSPFPGQANGALFRRGD......PSPGEAL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      88.92|      19|      19|     330|     348|       2
---------------------------------------------------------------------------
  310-  327 (23.67/11.07)	.KASTSDPHSSQTHVSTAA
  330-  348 (33.77/19.32)	EEAMTSPPFMQRALDQQTA
  351-  367 (31.47/17.44)	GIYPTPPDGMAQA..PQTA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.18|      18|      21|     469|     488|       3
---------------------------------------------------------------------------
  471-  488 (32.74/22.42)	EPVIAQDT.VNE..LQPTSDD
  490-  510 (21.44/ 6.17)	STAAAVDSaVSEhlTLPTSDD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     254.89|      82|     162|     963|    1049|       4
---------------------------------------------------------------------------
  963- 1049 (130.22/115.42)	EESVEGLlkAYAttCAELGKVLST..IGHEESDRTIVVYML..NPFS....G..RQALQHLCA..CFWVLFKAYRDNVPKALrNQCGSDIVLQVLPIKL
 1122- 1215 (124.67/92.70)	EGSILHL..AYA..CSQDGHWLTVawIDNTGQHQSTASFCLrgKTFSevaeGvwDRTREILAArqVTWRVFIVTPDAMDTSL.SHCWRSITSRRRPYPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.57|      20|      22|     162|     183|       5
---------------------------------------------------------------------------
  162-  183 (30.55/26.14)	LVPEILPASwlPIGHADEQVES
  187-  206 (36.02/22.25)	LAPRGIPAR..RIAEARRKVWS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      35.01|      10|      23|     722|     731|       6
---------------------------------------------------------------------------
  722-  731 (17.64/12.51)	SLRNSSDNYS
  747-  756 (17.37/12.20)	SMRKVEELYS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.88|      13|      23|     274|     286|      10
---------------------------------------------------------------------------
  274-  286 (24.42/16.98)	WLVGL.EEEDAFRN
  294-  307 (20.47/12.92)	WFKGAgEREQAVQN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.86|      22|      25|     389|     413|      12
---------------------------------------------------------------------------
  392-  413 (40.15/26.96)	NTND..HAQSNGSD.PDQSLDREDF
  416-  440 (29.70/10.88)	NQEDlfGDNSGGIEfGEDAVDDADF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.76|      14|      24|     207|     220|      15
---------------------------------------------------------------------------
  207-  220 (23.31/14.62)	DNAW.KVNVSEALEL
  228-  242 (19.44/10.85)	DTVWiSVELQDSAGL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP03972 with Med13 domain of Kingdom Fungi
Unable to open file!