<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03969
| Description |
RNA polymerase ii holoenzyme cyclin-like subunit like protein |
| Sequence | MAANYWDSTQAKFWTFAKAELSDLRKDLEKTNQPLHNRYTLPDRRLISIYIQQQLVKLARRMSLRQQALATAQIYIKRFYLRVEMRKTNPYLIMATAVYLACKMEECPQHIRLMLGEAARQWPELGVTETSKIGECEFALISTLSSRLICHHPYRSLSELGPIFGLSSEETQLAHSIVNDSYNTDLPLLYAPHIIAITAVFLAVVLRPSGQPPGLQAHSTQGSPVQLSSGMISPLSSSMPSFSPSVSGNAAQQAFLGGFSGLKQAGPKLSKLVDWLAESKVDMNSIVDATQELVSLYEVWESYSERTCKEAITKFVKDAGMAGGGLLNK |
| Length | 329 |
| Position | Kinase |
| Organism | Zymoseptoria brevis |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Zymoseptoria.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.122 |
| Instability index | 52.96 |
| Isoelectric point | 8.70 |
| Molecular weight | 36548.70 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP03969
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.13| 19| 24| 35| 57| 1
---------------------------------------------------------------------------
35- 53 (34.31/25.91) LHNRYTLPDRRLIS..IYIQQ
58- 78 (26.82/10.72) LARRMSLRQQALATaqIYIKR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.74| 22| 24| 222| 243| 2
---------------------------------------------------------------------------
222- 243 (39.32/23.63) GSPVQLS.SGMISPLSSSMPSFS
248- 270 (33.42/19.08) GNAAQQAfLGGFSGLKQAGPKLS
---------------------------------------------------------------------------
|