Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MALPPEHFKALDQLRLRLSQLSTSIGLLRNELEREQPLPTWPELQTAASSLGSNLQNLAATLSSQRQLFSSEHAYPLPDFPGHTQEGLLQQLLRKKLDPKAEAWISESLEGDKKTQNGTAEEQATLSSEDTMALWSWAGNAIGEMRTEMEDSGSFRDDYTLAERQAGISSVITGIKRKLGRDMDSEEEDDDEDDEDGNMDTKDEEMKDGHEADASASQGASLEGFNPTAPPIPLDTLLRFATGSNPLQAGSSV |
Length | 253 |
Position | Head |
Organism | Zymoseptoria brevis |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Zymoseptoria. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.734 |
Instability index | 44.74 |
Isoelectric point | 4.37 |
Molecular weight | 27718.09 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP03966 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 112.36| 35| 36| 4| 39| 1 --------------------------------------------------------------------------- 5- 39 (58.88/32.42) PEHFKALDQLRLRLSQLSTSIGLLRNELEREQ..PLP 42- 78 (53.48/24.68) PELQTAASSLGSNLQNLAATLSSQRQLFSSEHayPLP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IKRKLGR 2) KDEEMKDGHE 3) PIPLDTLLRFAT | 175 202 231 | 181 211 242 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab