<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03959

Description Mediator of RNA polymerase II transcription subunit 16
SequenceMDTNQIEEASMVDAAMMDPTMEDLFGEAANDLAVGDLGVGLPPIPLPPSLMLRIAELQHTGCCTKLAWSNTGSIARISEDGTQVTFHVMRRHRKTGQWCVGRPSRYPLKVPGGREFVHIQFSGIGIDLAVVDDLGIVHMHTLTGGLGRMVPAEGNISNHVTRNELHAVVGMHWLAVWTTEFTGPYIRPANKIGNKWEAQLQQRDQHSIKIHHPAMGRHAMLYITRSTELTLLYQNEGQGWQSTSIVIDEVRSSDQIISHAAMGEEGADLLVVTFDHSSRMRLYRVSIEWNATQHSLQAGMVYTLIAPTMEVHHLTASHHTRAQHAHSAQLTHLKIIPAVPEAAQTMPTATTILAVFTQTSVPSDANPPQNAYSIVSRWRVESLMPTLHDSFKKLSNARADSNGILNPTTVLRREPDIITNKAILAISSQMFDTMLAFTSSDGSIDLRDRLTMDQLGPFGSPTTVASLPQAGFDHLASTQNLHVALSANASGLAAISASDNSLTARPMTFTHGWTPSTPSALLDNTPYLEAGIVCLARQYAFLCYNSMSNDEVLSLLPYPAPNPSLHTTFLTQVFKMVNRSPDISMHESARQQMAVLKEPIVPRVLSAQLSLGTDPITGKRDVAAQYAYIFLNLRHIGTALAHTISQKDLSRVSPEAVHSLRPLVRWSIDLMIHIISTLSTLRQDPSTISTSSSPILPLLLASFSRALLRFQVLWVIKYLHLLQQIIPRLPTLAQRAELSATLELGTKSLPFKLPALEALLVDVDSAIRQVYSSGEVNAERRGEIEVGLICGGGEVPRELRAVVARLIDVGVGKVLDAEGTDVVKLRFWDMTWLGIERVQAPPPRSLHTNGTNTRKSPPTEAVFPGDMEIAGRWGYDVIRKVPLTEGMVVRECRRCGAVMEDFSPDRVRASPGWLGHAQKNCVCMNYWVCG
Length930
PositionTail
OrganismZymoseptoria brevis
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Zymoseptoria.
Aromaticity0.06
Grand average of hydropathy-0.069
Instability index44.04
Isoelectric point6.68
Molecular weight102261.17
Publications

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP03959
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      81.42|      23|      29|     504|     527|       1
---------------------------------------------------------------------------
  504-  527 (40.08/30.70)	ARPMTFtHGWTPSTPSALLDNTPY
  536-  558 (41.34/26.66)	ARQYAF.LCYNSMSNDEVLSLLPY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     305.32|     110|     196|     362|     498|       2
---------------------------------------------------------------------------
  362-  498 (150.04/163.98)	PSdANPP......QNAYSIVSRWrveslmP..TLHDSFKK....LSNARADSngILNPTTVLRREP.....DIITNKAILAISSQMFDTMLAFTSSDGsiDLrdrltmDQLgpfgSPTTVASL.P..QAGFD...HLASTqnlhvaLSANASGLAAISAS
  559-  691 (155.28/103.15)	PA.PNPSlhttflTQVFKMVNRS......PdiSMHESARQqmavLKEPIVPR..VLSAQLSLGTDPitgkrDVAAQYAYIFLNLRHIGTALAHTISQK..DL......SRV....SPEAVHSLrPlvRWSIDlmiHIIST......LSTLRQDPSTISTS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.63|      14|     286|       8|      22|       3
---------------------------------------------------------------------------
    8-   22 (22.18/19.07)	EASMVdAAMMDPTME
  297-  310 (26.45/17.08)	QAGMV.YTLIAPTME
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      99.70|      30|      43|     734|     763|       4
---------------------------------------------------------------------------
  734-  763 (48.43/30.16)	QRAELSATLELGTKSLPFKLPALEALLVDV
  780-  809 (51.27/32.33)	RRGEIEVGLICGGGEVPRELRAVVARLIDV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      94.45|      28|     739|     121|     174|       6
---------------------------------------------------------------------------
   71-   98 (51.39/42.72)	TGSIARISEDGTQVTFHVMRR..HRKTG.QW
  143-  173 (43.06/22.22)	TGGLGRMVPAEGNISNHVTRNelHAVVGmHW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.89|      13|     656|     248|     260|       9
---------------------------------------------------------------------------
  248-  260 (22.96/14.23)	DEVRSSDQIISHA
  905-  917 (25.93/17.10)	DRVRASPGWLGHA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.40|      12|     387|     332|     343|      10
---------------------------------------------------------------------------
  332-  343 (22.27/13.76)	HL..KIIPAVPEAA
  720-  733 (18.13/ 9.74)	HLlqQIIPRLPTLA
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP03959 with Med16 domain of Kingdom Fungi

Unable to open file!