<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03952
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MAPITLSQVDADLKEAIQHLFEIQSAVHGYLGPETQQELVRKIKSLTQTLSTLQKNTTNTPDPTDPTQATNPEISIGNPKDPNLASIQLPPEIIDYVDAARNPDIYTREFVELVQRGNQDLKGKREAFAEFRDVLAREVRSAVPGCRGEVDRVMESLGVGGDKGDTGGR |
| Length | 169 |
| Position | Middle |
| Organism | Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.575 |
| Instability index | 18.66 |
| Isoelectric point | 4.89 |
| Molecular weight | 18538.53 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP03952
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.93| 13| 16| 62| 74| 1
---------------------------------------------------------------------------
62- 74 (25.98/14.36) DPTDPTQAT...NPEI
78- 93 (20.96/10.43) NPKDPNLASiqlPPEI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.49| 12| 15| 102| 113| 3
---------------------------------------------------------------------------
102- 113 (22.53/16.56) NPDIY.TRE.FVEL
118- 131 (12.96/ 7.06) NQDLKgKREaFAEF
---------------------------------------------------------------------------
|