<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03947

Description MED6 mediator sub complex component
SequenceMASAQDGSMEEILWRSPAHVQMMGGFLHSNNILFYFAESPFFDATSNNASLAIQANYNETLRHFVETREAFEGRLKTMQGLEFVVAYDPLQAAAQTETSFAHEPSNIWVIRKQTRRKRAGLEDEVVVLSTYFVVGDCIYMAPSVASVVGNRLLSAVTSLTSLLKTASSLPSFTPSHGHTYMPPAPKPTDSSQPGAQSQQSKENTPMPDADSTKALFVGPQPANAGAILQDTRTFAESFSLLARYGEEFMDENPLVGEPGSFILSKSGDTDRGAASKQPPNVSRPGSIPGKVGTPQVKVDTPGKTPEKGATPSASDDISGNNSVHLETARALAHEFHRNNIQLVYGGGTAGLMGELARTLVTLSGPQAVHGIIPRALVKVEPGYNNAQEERNPSTVVSGKEAERVVKEPMGKIGTLKESEYGYTTIVPDMHTRKRMMAEKIREGGPGSGFVALAGGFGTIEEVMEMATWNQLGIHNLGMVLLNANGYWDGVLAWVKNSVQEGFVSPENGEILVEAKDVSEVWPKLVGYRISNGRMQLNWGEE
Length541
PositionHead
OrganismAspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
Aromaticity0.07
Grand average of hydropathy-0.325
Instability index40.32
Isoelectric point5.51
Molecular weight58488.18
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP03947
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.72|      14|      15|     281|     294|       1
---------------------------------------------------------------------------
  281-  294 (27.02/15.65)	VSRPGSIPGKVGTP
  298-  311 (25.71/14.53)	VDTPGKTPEKGATP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      92.52|      27|     115|      89|     115|       2
---------------------------------------------------------------------------
   89-  115 (48.24/30.84)	PLQAAAQTETSF.AHEPSNIWVIRKQTR
  205-  232 (44.27/27.71)	PMPDADSTKALFvGPQPANAGAILQDTR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.62|      14|      15|     347|     360|       3
---------------------------------------------------------------------------
  347-  360 (23.39/13.89)	GTAGLMGELARTLV
  364-  377 (25.24/15.53)	GPQAVHGIIPRALV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      27.86|       9|      20|     237|     246|       6
---------------------------------------------------------------------------
  237-  246 (11.95/14.37)	SFsLLARYGE
  260-  268 (15.91/11.75)	SF.ILSKSGD
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP03947 with Med6 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) EEFMDENPLVGEPGSFILSKSGDTDRGAASKQPPNVSRPGSIPGKVGTPQVKVDTPGKTPEKGATPSASDDISGNNSVHLETARAL
2) TPSHGHTYMPPAPKPTDSSQPGAQSQQSKENTPMPDADSTKALFVGPQPA
246
173
331
222










Molecular Recognition Features






MoRF SequenceStartStop




NANANA