<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03945
| Description |
Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinase |
| Sequence | MLKEHLDSRKPSGTGYTSKVRVRDKYHIVGFISSGTYGRVYKALGKNGQKGEFAIKKWAGSVRYFVSLGSLTSRRFKPDKEGEIIQYTGLSQSAIREMALCSELDHANVVQLEEIILEDKAIFMVFEYTEHDLLQIIHHHTQPHRHAIPAPMVRSILFQLLNGLLYLHTNWVLHRDLKPANILVTSSGAIRIGDLGLARLFYKPLNSLFSGDKVVVTIWYRAPELLMGSRHYTPAVDLWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMMKIIEIMGLPTKDIWPGIVSMPEYSQLQSLAMSRAPGHFPRSSNLEGWYQSCLKNGGYASSSGAGTPGADGYDLLSRLLEYDPTKRITAQEALEHPYFKNGGPISANCFEGFEGKYPHRRVTQDDNDIRSGSLPGTKRSGLPDDSLMGRASKRLKE |
| Length | 431 |
| Position | Kinase |
| Organism | Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.329 |
| Instability index | 41.56 |
| Isoelectric point | 9.28 |
| Molecular weight | 48375.03 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP03945
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 89.56| 29| 42| 307| 335| 2
---------------------------------------------------------------------------
316- 358 (42.54/25.32) RSSNLEGWYQSCLKNGGYASssgagtpgadgydlLSRLLEYDP
361- 392 (47.02/28.73) RITAQEALEHPYFKNGGPIS...........ancFEGFEGKYP
---------------------------------------------------------------------------
|