<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03939
| Description |
Subunit 21 of Mediator complex |
| Sequence | MADILTQLQTCLDQLATQFYATIGYLVTYHDNSPAIPPQNDPTAAPALAKITKNSTAPPVPAGAPAGSQASPQQQSAQIPGQQQQGGGDAGQTPGAGGGTGGTGADPNLPPAPDSPRTFASRQRELARDLVIKEQQIEYLISVLPGIDSSEAEQERRIKELEKELRSAEEDREQRVRELRKLRKKLENVLGAVEVGIYGDRGVVASRR |
| Length | 208 |
| Position | Middle |
| Organism | Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.637 |
| Instability index | 65.82 |
| Isoelectric point | 5.35 |
| Molecular weight | 22216.51 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP03939
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.82| 15| 16| 151| 166| 1
---------------------------------------------------------------------------
151- 166 (20.83/18.13) EAEQERRIKELEKeLR
169- 183 (25.98/17.36) EEDREQRVRELRK.LR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.49| 17| 17| 45| 61| 2
---------------------------------------------------------------------------
45- 61 (30.39/14.20) APALAKITKNSTAPPVP
64- 80 (28.09/12.66) APAGSQASPQQQSAQIP
---------------------------------------------------------------------------
|