<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03936
Description |
Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MSEDKTIPQQRPPAQDQTQILAAVDGQLRQTIEIILETGIALNDFEGGPHNHIYQKLNSIVEEYKELDRLAENVTVTVPRQVIEYVDEGRNPDLYTRQHADEALKKNQYMKGKLDTMKVPQVQWHVDEDFLLICVTEF |
Length | 138 |
Position | Middle |
Organism | Saitoella complicata (strain BCRC 22490 / CBS 7301 / JCM 7358 / NBRC 10748 / NRRL Y-17804) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Taphrinomycotina>
Taphrinomycotina incertae sedis> Saitoella.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.612 |
Instability index | 41.33 |
Isoelectric point | 4.75 |
Molecular weight | 15947.79 |
Publications | PubMed=21914972
PubMed=24646756
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP03936
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.62| 13| 38| 75| 88| 1
---------------------------------------------------------------------------
75- 88 (19.60/15.02) TVTVPrQVIEYVDE
116- 128 (27.03/15.93) TMKVP.QVQWHVDE
---------------------------------------------------------------------------
|