<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03930
Description |
Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MNVSQTNLKDESLKFLNHTGLDVLRQRLHQLSTSLTALNHRLHTEYPLPPYPSLLASFNAILAQFTIVKDALQKMQDELLENAVIPMEFPVRVHEGMLLTMMRSKPEPYVDEWIAQGKAYSEANPPGKGIPAGKERDEDDDDKDEDEEEEDEDEDTLWKFAAAIVATQIDQLNLKAAVQTTKVAELKKEVDETMGSIERVMRFVSRGTIVPGGQPQAQPSTGTAAIYLHMITLIYFVQFPSAEIP |
Length | 245 |
Position | Head |
Organism | Saitoella complicata (strain BCRC 22490 / CBS 7301 / JCM 7358 / NBRC 10748 / NRRL Y-17804) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Taphrinomycotina>
Taphrinomycotina incertae sedis> Saitoella.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.400 |
Instability index | 33.54 |
Isoelectric point | 4.71 |
Molecular weight | 27506.87 |
Publications | PubMed=21914972
PubMed=24646756
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP03930
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.39| 14| 15| 104| 118| 1
---------------------------------------------------------------------------
104- 118 (22.33/22.08) SKPEPyVDEWIAQGK
121- 134 (26.06/18.80) SEANP.PGKGIPAGK
---------------------------------------------------------------------------
|