Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MDGGAATNASGVAAAAAAAGNGVQAGGGGERAEDASKQNLALMMASIQRTLGLLHQLNLNVSSFSSASQLPLLQRLNSLVAELDTMQKHAEGCNIQVPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQVTKGKTDAFKSLRKHLLEELEQAFPEDVEAYREIRATAAAESKQLAQSQSALPNGDVKVKPEH |
Length | 190 |
Position | Middle |
Organism | Oryza rufipogon (Brownbeard rice) (Asian wild rice) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Oryza. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.329 |
Instability index | 31.64 |
Isoelectric point | 5.23 |
Molecular weight | 20107.35 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP03894 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 44.59| 13| 16| 46| 58| 1 --------------------------------------------------------------------------- 46- 58 (22.61/17.01) SIQRTLGLLHQLN 65- 77 (21.98/16.35) SSASQLPLLQRLN --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 45.21| 14| 16| 4| 17| 2 --------------------------------------------------------------------------- 4- 17 (21.31/12.76) GAATNASGVAAAAA 22- 35 (23.89/15.17) GVQAGGGGERAEDA --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AATNASGVAAAAAA 2) EAYREIRAT 3) GDVKVKPEH 4) LRKHLL | 5 156 182 139 | 18 164 190 144 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab