<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03877
| Description |
Uncharacterized protein |
| Sequence | MDIISQLQEQLNEMAMVAVNTFGTLQRDAPPVRLSNNYPDPLNPAAAAANPNPDDPAQPQPGAAAAAPGAPAAQAQAPPAQAQPPALDLAEHPKAMSHALVLAAKKFDALVSALPLSSEEDQLKRIKELQAENEVVGSELQKQLEAAELELKQVEALFNEATDHCINLKKPE |
| Length | 172 |
| Position | Middle |
| Organism | Oryza rufipogon (Brownbeard rice) (Asian wild rice) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.369 |
| Instability index | 51.19 |
| Isoelectric point | 4.57 |
| Molecular weight | 18231.35 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP03877
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.61| 19| 25| 41| 63| 1
---------------------------------------------------------------------------
41- 63 (33.53/20.47) PLNPAAAAANPnpddPAQPQPGA
68- 86 (39.08/15.43) PGAPAAQAQAP....PAQAQPPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.34| 21| 25| 112| 132| 2
---------------------------------------------------------------------------
112- 132 (33.49/18.04) SAL..PLSSEEDQLKRIKELQAE
138- 160 (27.85/14.09) SELqkQLEAAELELKQVEALFNE
---------------------------------------------------------------------------
|