Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MEEAESRPAPPDPNDARQRFLLELEFIQCLANPTYIHYLAQNRYFEDEAFIGYLKYLKYWQRPKYIKYLMYPHCLFFLELLQNANFRNAMAHPASKEVAHRQQYFFWKNYRNNRLKHILPRPPPEPTPMPATAPAAVPPAAPVPSTVVPPAAAPPSSLPPMSAAGASAMSPMQFAGTPGTNIPKNDMRNVMGGQGGRKRKIG |
Length | 202 |
Position | Middle |
Organism | Oryza rufipogon (Brownbeard rice) (Asian wild rice) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Oryza. |
Aromaticity | 0.11 |
Grand average of hydropathy | -0.514 |
Instability index | 62.13 |
Isoelectric point | 9.63 |
Molecular weight | 22810.09 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP03869 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 45.67| 14| 14| 126| 139| 2 --------------------------------------------------------------------------- 122- 137 (23.98/ 7.58) PPpePTPMPATAPAAV 138- 153 (21.69/ 6.27) PPaaPVPSTVVPPAAA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 29.61| 8| 27| 76| 88| 3 --------------------------------------------------------------------------- 76- 88 (10.66/15.29) FFLEllqnaNFRN 105- 112 (18.94/10.27) FFWK.....NYRN --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GRKRKIG 2) WKNYRNNRL | 196 107 | 202 115 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab