<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03849
| Description |
Uncharacterized protein |
| Sequence | MTRHLIKSCLSSSGPTRHNPFGGLLVTLPPCPPLPPPAIPIHPASEQGAVVLPATSILVSTSSATADPQPSRERASDRRSSCCFRHIGGPWTCTLQMSGFNRMGSDGNFGKGPRELTGAVDLISRYKLLNHHSFFCKKPLPLAISDTNYLHNVVGDTEIRKGEGMELDQLFQDAYLREKTSYIQPFDMETLGQAFQLRETAPIDLPSAEKGTPTISGKSKIKSKDKVKKHKRHKEKDKDKYKDQKKHKHRHKDRSKDKEKEKEKEKEKEKKKDKSAHHDSGADRSKKHHEKKRKQEGLEDLASGHNPKKVTLIF |
| Length | 314 |
| Position | Head |
| Organism | Oryza rufipogon (Brownbeard rice) (Asian wild rice) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.009 |
| Instability index | 46.61 |
| Isoelectric point | 9.66 |
| Molecular weight | 35302.90 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP03849
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 75.05| 15| 15| 228| 242| 1
---------------------------------------------------------------------------
228- 242 (28.72/14.54) KKHKRHKEKDKDKYK
245- 258 (26.62/12.96) KKHK.HRHKDRSKDK
260- 272 (19.71/ 7.77) K..EKEKEKEKEKKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.71| 15| 20| 170| 188| 2
---------------------------------------------------------------------------
170- 188 (23.01/24.92) LFQDAYLREKTsyiqPFDM
191- 205 (26.69/16.77) LGQAFQLRETA....PIDL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.72| 15| 15| 278| 292| 3
---------------------------------------------------------------------------
278- 292 (26.81/13.56) HDSG.ADRSKKHHEKK
294- 309 (21.91/ 9.94) KQEGlEDLASGHNPKK
---------------------------------------------------------------------------
|