<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03813
| Description |
Uncharacterized protein |
| Sequence | MLQGENFGVGSGPYPVTLAIFVRIPPRQFALVHRLRLRLRRSPSIPRASRDAVVSPAASAASILRKMDQHHVQQQQYVDPYRTMVLSPQPDHLNALQYNHQQQPQPPPQATPPPPQHHHASLASHFHLLHLTTRLADAIGKGTRDQNSDALVEDLTSQFARCQQLLNSISGTLSSKSIDPDPKIQ |
| Length | 185 |
| Position | Middle |
| Organism | Oryza rufipogon (Brownbeard rice) (Asian wild rice) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.527 |
| Instability index | 50.65 |
| Isoelectric point | 9.99 |
| Molecular weight | 20581.11 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP03813
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.46| 15| 26| 69| 83| 2
---------------------------------------------------------------------------
69- 83 (29.62/11.93) QHHVQQQQYVDPYRT
97- 111 (30.84/12.65) QYNHQQQPQPPPQAT
---------------------------------------------------------------------------
|