<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03807
| Description |
Uncharacterized protein |
| Sequence | MDSDDKKFGKGPRELTGAVDLISHYKLLAHHDFFCKKPLPLAISDTHYLHNVVGDTEIRKGEGMELDQLVQNAYLRDKPAYIQPFDMETLGQAFQLRETAPVDLPSAEKGIPTISGKPKSESKDKEKKHKKHKDKDRDKDKEHKKHKHRHKDRSKDRDKDKDKDKKKDKSGHHDSGGDHSKKHHEKKRKHEGMEDSADVHKHKKSKHKSSRTDDTGNGLS |
| Length | 220 |
| Position | Head |
| Organism | Oryza punctata (Red rice) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.591 |
| Instability index | 29.32 |
| Isoelectric point | 9.39 |
| Molecular weight | 25279.04 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP03807
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.44| 18| 37| 153| 178| 2
---------------------------------------------------------------------------
157- 175 (29.06/13.50) RDKdKDKDKKKDKSGHHDS
179- 196 (32.38/ 6.92) HSK.KHHEKKRKHEGMEDS
---------------------------------------------------------------------------
|